DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina1f

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_080963.2 Gene:Serpina1f / 68348 MGIID:1915598 Length:411 Species:Mus musculus


Alignment Length:386 Identity:83/386 - (21%)
Similarity:176/386 - (45%) Gaps:43/386 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL-----GLPSE 69
            |....|..|..:::.:::...|.|::.||:.:...:||:.:|:.|:.:|.:...|     |||..
Mouse    44 VALTICNVSITLFKKMAQLSGNGNILFSPIRVIAAISMLSLGSNGNLSKHILETLRFNKTGLPEA 108

  Fly    70 DKEAVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPV 134
            :   :...:..||:.:...||...|:..:.::::...:....:...|::.:.|:..||:.|:...
Mouse   109 E---IHKCFWYLLHSIHQTEEPSSLQTGSSVFIHQDLTSVDKFVKGVKDLYHSDMISINFTDSSQ 170

  Fly   135 AAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKS 199
            |..:||.:|::::..:|..::.  ::.||....:||.|.:..:.:|.|.....:...:.:....:
Mouse   171 AKTQINNYVMEKSQKEIVNIVK--NLESDTFLAVVNYIIWNAKLDSNFGCRSVKVKDYHLGYGMT 233

  Fly   200 VPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIV-----GFARP 259
            :.|.|:..|.........||.:.|:.|..|..|.: |.|:..:...:..:|:.:.     ...|.
Mouse   234 IKVPMIHNMAMHYLFRVEDLSSTVLMLTLLTGNFA-TYFIIPDPGKMQKVEQSLTYPHFRRMRRQ 297

  Fly   260 LVAKEVYLKLPKFKIEFRDELKETLEKLGIRELF---TDKSDLSGLFADKSGGKVSQVSHKAFLE 321
            |:.:.|.|::|:..:....:|:..:..|||..:|   |:.||::....     |..:|..||.|.
Mouse   298 LLTRLVDLEIPELSLSETHDLESMMSLLGITYVFNSGTNSSDMNDTLQ-----KSFKVVSKAVLT 357

  Fly   322 VNEEGAEAA--------GATSVAVTNRAGFSTFLMADHPFAFVIRD-ANTI-YFQGRVVSP 372
            ::|:|::.:        |:|.:.         .:..:.||...|:| .|.: .|.||||:|
Mouse   358 IDEKGSKPSTNSCFKKLGSTDMG---------RMQLNRPFLIFIQDHTNDVPLFLGRVVNP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 77/375 (21%)
Serpina1fNP_080963.2 Serpin 48..409 CDD:278507 81/380 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.