DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina5

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001231668.1 Gene:Serpina5 / 65051 RGDID:619817 Length:442 Species:Rattus norvegicus


Alignment Length:377 Identity:105/377 - (27%)
Similarity:192/377 - (50%) Gaps:20/377 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTSVACQTSKE----IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSE- 69
            |.:|....|::    :|:.|:.....||:..||:|:...|.|:.:|:...|..::...|||..: 
  Rat    72 VGAVGTSRSRDFAFRLYRALASEAPGQNVFFSPMSVSMSLGMLSLGSGLKTKAQILEGLGLSLQQ 136

  Fly    70 -DKEAVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGP 133
             .::.:...:..||.......:|..|.|.:.::.:....:..::..|::..:.|:..|.:..|..
  Rat   137 GQEDMLHKGFQQLLQQFSQPSDGLQLSLGSALFTDPAVHIRDHFLSAMKTLYMSDMFSTNFGNPE 201

  Fly   134 VAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANK 198
            .|.::||.:|..:|:|||..:|.  .:.|....::||.|:||.:|::.|....|....:.||..|
  Rat   202 SAKKQINDYVAKKTNGKIVDLIK--DLDSTHVMVVVNYIFFKAKWQTAFSSTNTHKMDYHVTPKK 264

  Fly   199 SVPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPRE------VEGLSALEEKIVGFA 257
            ::.|.||.:...:.....:::...|:.:||..:..::.| ||.|      .:||.  |..:..:.
  Rat   265 TIQVPMMNREDIYSYILDQNISCTVVGIPYQGNTFALFI-LPSEGKMKRVEDGLD--ERTLRNWL 326

  Fly   258 RPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEV 322
            :....:::.|.||||.||...:|::.|.||||:::||..:||||| .|.:..|:|::.||:.:||
  Rat   327 KMFTKRQLDLYLPKFSIEGTYKLEKILPKLGIQDIFTTHADLSGL-TDHTNIKLSEMVHKSMVEV 390

  Fly   323 NEEGAEAAGATSVAVTNRAGFSTFLMAD--HPFAFVIRDANTIYFQGRVVSP 372
            :|.|..||.:|.:..|.|:...:.|..:  .||..||.|...:||.|:|:.|
  Rat   391 DESGTTAAASTGILFTLRSARPSSLKVEFTRPFLVVIMDGTNLYFIGKVIQP 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 101/366 (28%)
Serpina5NP_001231668.1 alpha-1-antitrypsin_like 81..439 CDD:239011 100/363 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.