DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPINB3

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_008850.1 Gene:SERPINB3 / 6317 HGNCID:10569 Length:390 Species:Homo sapiens


Alignment Length:381 Identity:140/381 - (36%)
Similarity:208/381 - (54%) Gaps:32/381 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP--SEDKEAVAARYGA-- 80
            :::|...||..| |:..||:||.:.|.||.:||:.:||::::..|...  :|:....||.|..  
Human    14 DLFQQFRKSKEN-NIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDR 77

  Fly    81 ----------LLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGP-V 134
                      ||.:.....:...||:||:::....|...|.|..|:::.:::..||:...|.| .
Human    78 SGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEE 142

  Fly   135 AAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKS 199
            :.::||.||..||:.|||.:|..|::.|:...:||||||||||||.||:...|:...|....|..
Human   143 SRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTY 207

  Fly   200 VPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVGFARPLV--- 261
            ..:|||.|..:|......|:.|:|:|:||...:|||.:.||.|::||..||||:.  |..|:   
Human   208 KSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLT--AEKLMEWT 270

  Fly   262 ------AKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFL 320
                  ...|.|.||:||:|...:||:||..:|:.::|...:||||:...: |..:|.|.||||:
Human   271 SLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSR-GLVLSGVLHKAFV 334

  Fly   321 EVNEEGAEAAGATSVAVTNRAGFST--FLMADHPFAFVIRD--ANTIYFQGRVVSP 372
            ||.|||||||.||:|.....:..||  ....:|||.|.||.  .|:|.|.||..||
Human   335 EVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 137/376 (36%)
SERPINB3NP_008850.1 serpinB3_B4_SCCA1_2 1..390 CDD:381030 138/379 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.