DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina3i

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_017170641.1 Gene:Serpina3i / 628900 MGIID:2182841 Length:457 Species:Mus musculus


Alignment Length:400 Identity:128/400 - (32%)
Similarity:185/400 - (46%) Gaps:48/400 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWVTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGL-----P 67
            |.|.|.....:..:|:.|...:.::|:|.||.||.|.|:::.:||:.:|.||:...|..     |
Mouse    70 LTVASSNTDFAFSLYRKLVLKNPDENVVFSPFSIFTALALLSLGAKSNTLKEILEGLKFNLTETP 134

  Fly    68 SEDKEAVAARYGALLNDLQGQEEGPI-LKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTN 131
            ..|... ..||   |.||..|....: :...:.::|.....:...:....|..:::||.:.....
Mouse   135 EPDIHQ-GFRY---LLDLLSQPGDQVQISTGSALFVEKHLQILAEFKEKARALYQAEAFTADFLQ 195

  Fly   132 GPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFK--------------GQWESKF 182
            ...|.:.||.:|.:||.||||.:|  ..:......:|||.||||              |:|:..|
Mouse   196 PCQAKKLINDYVSNQTQGKIKELI--SDLDKSTLMVLVNYIYFKGGRGHCLGVEREELGKWKMPF 258

  Fly   183 DPAKTRASTFQVTANKSVPVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLP----- 240
            ||..|..|.|.:...:||.|.|| ::......||||  |...|:||.| ..|.|....||     
Mouse   259 DPRDTFNSKFYLDEKRSVKVPMM-KIEELTTPYFRDDELSCSVVELKY-TGNASALFILPDQGKM 321

  Fly   241 REVEGLSALEEKIVGFARPLVAKEV-YLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFA 304
            ::|| .|...|.:..:...|....: .|.||||.|.....|:..|..|||||:|:.::|||.:  
Mouse   322 QQVE-TSLHPETLRKWKNSLKPSRISELHLPKFSISNDYSLEHVLPVLGIREVFSMQADLSAI-- 383

  Fly   305 DKSGG---KVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAG--FSTFLMADHPFAFVIRDANT-- 362
              :|.   :||||.|||.|:|.|.|.|||.||.|.|..|.|  :|..:....||..:|.|.||  
Mouse   384 --TGTMDLRVSQVVHKAVLDVTETGTEAAAATGVKVNLRCGKIYSMTIYFKRPFLIIISDINTHI 446

  Fly   363 IYFQGRVVSP 372
            ..|..:|.:|
Mouse   447 ALFMAKVTNP 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 123/387 (32%)
Serpina3iXP_017170641.1 serpinA3_A1AC 62..457 CDD:381019 127/399 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.