DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpinb2

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_067728.1 Gene:Serpinb2 / 60325 RGDID:621823 Length:416 Species:Rattus norvegicus


Alignment Length:415 Identity:129/415 - (31%)
Similarity:208/415 - (50%) Gaps:60/415 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALG---------- 65
            |..|....|:|.|    |::.||:.:||.||.:.|::||:||:.:|.:::...|.          
  Rat     9 TMFALNLLKQIEQ----SNSTQNIFISPWSISSTLAIVFLGAQANTEEQMAKVLNFDKIGSYDLT 69

  Fly    66 -------------------------LPSEDKEAVAARYGALLNDLQGQEEGP-ILKLANRIYVND 104
                                     |.::.::.:.:.:.:|.:.:.....|. :|:.||:::...
  Rat    70 PGNPENFHGCDFAQHIQRDNYPVAILQAQARDKIHSAFSSLSSTINTPRLGDYLLESANKLFGEK 134

  Fly   105 QYSLNQNYNLAVREPFKSEAESIS-LTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALL 168
            .....:.|....::.:.:|.|::. |.....|.::||.||..||.|:|..::..||:..|.|.:|
  Rat   135 SARFKEEYIQRCKKYYSTEPEAVDFLECANEARKKINSWVKTQTKGEIPNLLPEGSVDEDTKMVL 199

  Fly   169 VNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNL 233
            ||.|||||:|::.|.........|:|..|:|.|||||.........|.:||..|::||||: .|:
  Rat   200 VNTIYFKGRWKTPFQKRLNGLYPFRVNLNESKPVQMMYLREKLNIGYIKDLKTQILELPYI-GNI 263

  Fly   234 SMTIFLPREVE----GLSALEEKIVGF--ARPLVAKE------VYLKLPKFKIEFRDELKETLEK 286
            ||.:.||.|:|    ||..||.:| .|  ....::||      |.:.:||||:....|||..|::
  Rat   264 SMFLLLPDEIEDSSTGLEMLEREI-NFDNFNKWISKETLDEDDVLVYIPKFKLAQNYELKPILQR 327

  Fly   287 LGIRELFT-DKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGF-STFLMA 349
            :|:.:.|. .|:|.||: ::.:...:|:|.|:|.::|||||..|||.|...:|.|.|. ....:|
  Rat   328 MGMEDAFNKGKADFSGM-SESNDLFLSEVFHQATVDVNEEGTVAAGGTGAVMTGRTGHGGPQFVA 391

  Fly   350 DHPFAFVIRD--ANTIYFQGRVVSP 372
            ||||.|.|.:  ..||.|.||..||
  Rat   392 DHPFLFFIMNNITRTILFVGRFSSP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 124/405 (31%)
Serpinb2NP_067728.1 serpinB2_PAI-2 2..416 CDD:381029 127/413 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm12319
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.