DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and serpinb1l2

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001038636.1 Gene:serpinb1l2 / 568898 ZFINID:ZDB-GENE-041001-117 Length:382 Species:Danio rerio


Alignment Length:373 Identity:138/373 - (36%)
Similarity:205/373 - (54%) Gaps:25/373 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLND 84
            ::|:.||.|....|:..||:||...||||::||.|.||.|::..|...|...  ..|.:..|::.
Zfish    14 DLYRALSASSAEGNIFFSPLSISAALSMVYLGARGDTAGEMEKVLCFSSVSD--FHAHFKTLISS 76

  Fly    85 LQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAER-INQWVLDQTS 148
            :.......||:||||:|....:|....|..:..:.:.:|.:::........:.: ||:||..||.
Zfish    77 INSPSASYILRLANRLYGEKTFSFLPMYVDSTMKLYHAEPQTVDFIRAADDSRQFINKWVEKQTE 141

  Fly   149 GKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRA 213
            .:||.::.||.:....:.||||||||||.|...||...|:...|::..|:|.|||||.|:..|..
Zfish   142 NQIKDLLQPGVVNEMTRLLLVNAIYFKGNWMHTFDAHATKEMPFKINQNESRPVQMMDQVENFPY 206

  Fly   214 NYFRDLDAQVIELPYLNSNLSMTIFLPREV----EGLSALE-----EKIVGF---ARPLVAKEVY 266
            ....:...||:||||....|||.|.||.|:    :.|..||     :|::.:   .:....:::.
Zfish   207 RCIPEYKLQVLELPYTQQELSMLILLPDEIKYGSDPLLKLESELNLQKLLDWTSRGKMDTWRKII 271

  Fly   267 LKLPKFKIEFRDELKETLEKLGIRELFTD-KSDLSGLFADKSGGK-VSQVSHKAFLEVNEEGAEA 329
            ::|||||:|....|.|||||:|:..:|.: |:||:|:  ..:||. :|.|.||||:||||||.||
Zfish   272 VRLPKFKLEIESCLSETLEKMGMSSVFQETKADLTGM--SSNGGLFLSAVIHKAFVEVNEEGTEA 334

  Fly   330 AGATSVAVTNRA---GFSTFLMADHPFAFVIR--DANTIYFQGRVVSP 372
            |.||::.:...|   .|..|: |||||.|.||  ..|:|.|.||..:|
Zfish   335 AAATALLLPISACQGAFHDFI-ADHPFMFFIRHNPTNSILFLGRFRAP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 136/368 (37%)
serpinb1l2NP_001038636.1 SERPIN 5..381 CDD:294093 137/371 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 229 1.000 Domainoid score I2400
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8430
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.