DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPINB8

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001353127.1 Gene:SERPINB8 / 5271 HGNCID:8952 Length:374 Species:Homo sapiens


Alignment Length:364 Identity:127/364 - (34%)
Similarity:202/364 - (55%) Gaps:16/364 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLNDL 85
            ::::|.:...::|:..||:||.:.|:||||||:||||.::..||.|..:..  :...:.:||:::
Human    15 LFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGD--IHRGFQSLLSEV 77

  Fly    86 QGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAER-INQWVLDQTSG 149
            .......:|:.|||::.........::....::.:::|.|.:|.........: ||.||.::|.|
Human    78 NRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEG 142

  Fly   150 KIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRAN 214
            ||..::|.|::....|.:|||||||||:|..:||...||...|:....|.. ||||.:...|:..
Human   143 KISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKT-VQMMFKEAKFKMG 206

  Fly   215 YFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGF--ARPLVAKEVYLKLPKF 272
            |..::..||:||||:...|||.|.||.:...|:.:|     ||...:  :..|...:|.:.||:.
Human   207 YADEVHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRL 271

  Fly   273 KIEFRDELKETLEKLGIRELFTD-KSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVA 336
            |:|...:|:..|.:||:.:.|.: |:|.||:..:|: ..:|:|:||.|:||||||.|||.||:|.
Human   272 KLEESYDLEPFLRRLGMIDAFDEAKADFSGMSTEKN-VPLSKVAHKCFVEVNEEGTEAAAATAVV 335

  Fly   337 VTNRAG-FSTFLMADHPFAFVIR--DANTIYFQGRVVSP 372
            ..:|.. ......|||||.|.||  ..|.|.|.||..||
Human   336 RNSRCSRMEPRFCADHPFLFFIRHHKTNCILFCGRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 124/359 (35%)
SERPINB8NP_001353127.1 SERPIN 4..374 CDD:320777 125/362 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.