DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPINB5

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_002630.2 Gene:SERPINB5 / 5268 HGNCID:8949 Length:375 Species:Homo sapiens


Alignment Length:373 Identity:115/373 - (30%)
Similarity:189/373 - (50%) Gaps:31/373 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLND 84
            ::::.|.:.....|::.||:.:.|.||:..:||:|.||.|:...|..  |:.:.|...:..:.:|
Human    14 DLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHF--ENVKDVPFGFQTVTSD 76

  Fly    85 LQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISL------TNGPVAAERINQWV 143
            :........|||..|:||:...:|:..:..:.:.|:..|.|::..      |.|     :||..:
Human    77 VNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKG-----QINNSI 136

  Fly   144 LDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQM 208
            .|.|.|..:.::...|:....|.|:|||.||.|:|..||..::|:...|:|....:.|||||...
Human   137 KDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKPVQMMNME 201

  Fly   209 GTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVE----GLSALE-----EKIVGFARP--LVA 262
            .||.......::.::||||:.|.:|||.|.||::||    ||..:|     |.:..:..|  :..
Human   202 ATFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVEDESTGLEKIEKQLNSESLSQWTNPSTMAN 266

  Fly   263 KEVYLKLPKFKIEFRDELKETLEKLGIRELFT-DKSDLSGLFADKSGGKVSQVSHKAFLEVNEEG 326
            .:|.|.:||||:|...:.|..||.||::.:|: |.||.||: ::..|..:|.|.||..||:.|:|
Human   267 AKVKLSIPKFKVEKMIDPKACLENLGLKHIFSEDTSDFSGM-SETKGVALSNVIHKVCLEITEDG 330

  Fly   327 AEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372
            .::.......:...   ...|.|||||.::||...|  |.|.|:..||
Human   331 GDSIEVPGARILQH---KDELNADHPFIYIIRHNKTRNIIFFGKFCSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 113/368 (31%)
SERPINB5NP_002630.2 maspin_like 4..375 CDD:239012 113/371 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.