DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPINA1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_000286.3 Gene:SERPINA1 / 5265 HGNCID:8941 Length:418 Species:Homo sapiens


Alignment Length:383 Identity:112/383 - (29%)
Similarity:185/383 - (48%) Gaps:37/383 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP-SEDKEA 73
            :|....:.:..:|:.|:....:.|:..|||||.|..:|:.:|.:..|..|:...|... :|..||
Human    50 ITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEA 114

  Fly    74 -VAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAE 137
             :...:..||..|...:....|...|.:::::...|...:...|::.:.|||.:::..:...|.:
Human   115 QIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKK 179

  Fly   138 RINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPV 202
            :||.:|...|.|||..::.  .:..|....|||.|:|||:||..|:...|....|.|....:|.|
Human   180 QINDYVEKGTQGKIVDLVK--ELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKV 242

  Fly   203 QMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEK-----IVGFARPLVA 262
            .||.::|.|...:.:.|.:.|:.:.|| .|.:...|||.|.: |..||.:     |..|......
Human   243 PMMKRLGMFNIQHCKKLSSWVLLMKYL-GNATAIFFLPDEGK-LQHLENELTHDIITKFLENEDR 305

  Fly   263 KEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGA 327
            :...|.|||..|....:||..|.:|||.::|::.:||||: .:::..|:|:..|||.|.::|:|.
Human   306 RSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGV-TEEAPLKLSKAVHKAVLTIDEKGT 369

  Fly   328 EAAGATSVAVTNRAGFSTFLMA-----------DHPFAFVIRDANT--IYFQGRVVSP 372
            |||||            .||.|           :.||.|::.:.||  ..|.|:||:|
Human   370 EAAGA------------MFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 108/372 (29%)
SERPINA1NP_000286.3 alpha-1-antitrypsin_like 55..412 CDD:239011 108/373 (29%)
RCL 368..392 9/35 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.