DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPINA5

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:364 Identity:116/364 - (31%)
Similarity:193/364 - (53%) Gaps:19/364 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGL---PSEDKEAVAARYGAL 81
            ::|:.|:.:..:|::..|||||...|:|:.:||..||..::...|||   .|.:|| :...:..|
Human    51 DLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKE-LHRGFQQL 114

  Fly    82 LNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQ 146
            |.:|....:|..|.|.|.::.:....|...:..|::..:.::....:..:...|.::||.:|..|
Human   115 LQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQ 179

  Fly   147 TSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTF 211
            |.|||..::.  ::.|:...::||.|:||.:||:.|:...|:...|.||:...|.|.||::...:
Human   180 TKGKIVDLLK--NLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQY 242

  Fly   212 RANYFRDLDAQVIELPYLNSNLSMTIFLPRE-----VE-GLSALEEKIVGFARPLVAKEVYLKLP 270
            .....|:|..:|:.:|| ..|.:....||.|     || |||  |:.:..:.:....:::.|.||
Human   243 HYLLDRNLSCRVVGVPY-QGNATALFILPSEGKMQQVENGLS--EKTLRKWLKMFKKRQLELYLP 304

  Fly   271 KFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSV 335
            ||.||...:|::.|..|||..:||..:||||: ::.|..:||::.|||.:||:|.|..||.||..
Human   305 KFSIEGSYQLEKVLPSLGISNVFTSHADLSGI-SNHSNIQVSEMVHKAVVEVDESGTRAAAATGT 368

  Fly   336 AVTNRAG--FSTFLMADHPFAFVIRDANTIYFQGRVVSP 372
            ..|.|:.  .|..|:.:.||...|.| |.|.|.|:|..|
Human   369 IFTFRSARLNSQRLVFNRPFLMFIVD-NNILFLGKVNRP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 114/359 (32%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 114/359 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.