DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPINE1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens


Alignment Length:361 Identity:109/361 - (30%)
Similarity:179/361 - (49%) Gaps:15/361 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WVTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDK-E 72
            :|..:|......::|.::::..::|:|.||..:.::|:|:.:...|.|.:::|:|:|...:|| .
Human    30 YVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKIDDKGM 94

  Fly    73 AVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAE 137
            |.|.|:  |..:|.|......:...:.|:|.....|.|.:.......|:|..:.:..:....|..
Human    95 APALRH--LYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDFSEVERARF 157

  Fly   138 RINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPV 202
            .||.||...|.|.|..::..|::....:.:||||:||.|||::.|..:.|....|..:...:|.|
Human   158 IINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQWKTPFPDSSTHRRLFHKSDGSTVSV 222

  Fly   203 QMMAQMGTFRANYFRDLDA---QVIELPYLNSNLSMTIFLPREVE-GLSAL-----EEKIVGFAR 258
            .||||...|....|...|.   .::||||....|||.|..|.|.| .||||     .:.|..:..
Human   223 PMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKG 287

  Fly   259 PLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTD-KSDLSGLFADKSGGKVSQVSHKAFLEV 322
            .:......|.||||.:|...:|::.||.||:.::|.. ::|.:.| :|:....|:|...|..:||
Human   288 NMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADFTSL-SDQEPLHVAQALQKVKIEV 351

  Fly   323 NEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIR 358
            ||.|..|:.:|:|.|:.|......:| |.||.||:|
Human   352 NESGTVASSSTAVIVSARMAPEEIIM-DRPFLFVVR 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 107/354 (30%)
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 109/361 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.