DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and serpinb1l1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001009892.2 Gene:serpinb1l1 / 494155 ZFINID:ZDB-GENE-040715-5 Length:384 Species:Danio rerio


Alignment Length:377 Identity:136/377 - (36%)
Similarity:208/377 - (55%) Gaps:22/377 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPS---EDKEAVAAR 77
            |.|..:::.:|..:.:.|:..|||||.:.|:||.:||:|:||.::...||..|   :..|.:.:.
Zfish    10 QFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNSQAHQPVEQIHSN 74

  Fly    78 YGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTN-GPVAAERINQ 141
            :...:::|...|...:|.||||:|....|.|.:.:....:..:.:..|.:...| ...|...||.
Zfish    75 FKKFMSELNKPEAPYVLSLANRLYGEQTYQLIEKFLNDTKRYYDAGLEKVDFINKSEDARVNINT 139

  Fly   142 WVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMA 206
            ||...|..|||.::..|::.:..:.:|||||||||.||.||....||...|::..|::.||:||.
Zfish   140 WVEKNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEEKFPKEATRDGVFRLNKNQTKPVKMMH 204

  Fly   207 QMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVE----GLSALE-----EKIVGFARPLV- 261
            |...|.:.|..::.:.|:||||...||||.|.||.|:|    ||..||     ||::.:.:|.| 
Zfish   205 QKAEFPSGYIEEMKSHVLELPYAGKNLSMLIILPDEIEDETTGLQKLERALTYEKLMEWTKPEVM 269

  Fly   262 -AKEVYLKLPKFKIEFRDELKETLEKLGIRELF-TDKSDLSGLFADKSGGKVSQVSHKAFLEVNE 324
             .:||.:.|||||.|...::|..|..:|:.::| ..|.:|:|: :..:...:|:..||||:||||
Zfish   270 HQREVQVSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGM-SSSNDLVLSKAIHKAFVEVNE 333

  Fly   325 EGAEAAGATSVAVTNRAGFSTFLM--ADHPFAFVIR--DANTIYFQGRVVSP 372
            ||.|||.||: |:.....:...|.  |||||.|.||  ...:|.|.||:.||
Zfish   334 EGTEAAAATA-AIEKLMCYIPPLSFNADHPFLFFIRHNPTKSILFYGRLCSP 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 133/372 (36%)
serpinb1l1NP_001009892.2 PAI-2 4..384 CDD:239013 134/375 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8430
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.