DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and serpinc1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001008153.1 Gene:serpinc1 / 493515 XenbaseID:XB-GENE-975782 Length:456 Species:Xenopus tropicalis


Alignment Length:372 Identity:122/372 - (32%)
Similarity:190/372 - (51%) Gaps:25/372 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YQLLSKSHTN-QNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP--SEDKEAVAARYGALLN 83
            |:.|:.|..| :|:.:||:||....:|..:||..:|.|||.......  ||........:.|.||
 Frog    86 YKNLADSKQNTENIFMSPLSISQAFTMAKLGACNNTLKELMEVFYFDTISERASDQIHYFFAKLN 150

  Fly    84 D--LQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGP-VAAERINQWVLD 145
            .  .:...:...|...||::.....:.|:.|.......:.::...::....| ::.|.||.||.|
 Frog   151 CRLFRKANKSSELVSVNRLFGEKSLTFNETYQDISELVYGAKLLPLNFKEKPELSREIINNWVSD 215

  Fly   146 QTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGT 210
            :|..:|..:|..|.:|.|...:|:|||||||.|:|||:...|:...|....:.......|.|.|.
 Frog   216 KTEKRITDVIPVGVITPDTVLVLINAIYFKGLWKSKFNSENTKMEQFYPDESNHCLAATMYQEGI 280

  Fly   211 FRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGFARPLVAKEVYLKLP 270
            ||.:.|:|...||:||||...:::|.:.||.....|..:|     ||:..:.:.....::.:.||
 Frog   281 FRYSSFKDDGVQVLELPYKGDDITMVLVLPSPETPLMKVEQNLTLEKLGNWLQKSRELQLSVYLP 345

  Fly   271 KFKIEFRDELKETLEKLGIRELFTDKS-DLSGLFADKSGGK----VSQVSHKAFLEVNEEGAEAA 330
            :|::|....:||.|:::|:.:||...| .|.|:.|   ||:    ||...|||||||||||:|||
 Frog   346 RFRVEDSFSVKEKLQQMGLVDLFDPNSAKLPGIVA---GGRTDLYVSDAFHKAFLEVNEEGSEAA 407

  Fly   331 GATSVAVTNRA---GFSTFLMADHPFAFVIRDA--NTIYFQGRVVSP 372
            .:|:|.:|.|:   ...|| .|:.||...||:.  |::.|.|||.:|
 Frog   408 ASTAVILTGRSLNLNRITF-RANRPFLVFIREVAINSVLFMGRVANP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 119/367 (32%)
serpinc1NP_001008153.1 serpinC1_AT3 61..455 CDD:381002 122/372 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.