DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Spn88Eb

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:393 Identity:118/393 - (30%)
Similarity:177/393 - (45%) Gaps:60/393 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP-SEDKEAVAARYGALL 82
            :|||       .:.||..||.|....|.:.:..:...|.:||..||.|. :.:|:.|...|..  
  Fly    50 REIY-------PSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL-- 105

  Fly    83 NDLQGQEE-----GPI-LKLANRIYVNDQYSLNQNYNL----AVRE-PFKSEAESISLTNGPVAA 136
              .|.|:|     .|: |..||||:|:...:::..:|.    |.:| .||::.|:        ..
  Fly   106 --AQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGATKELDFKNDPET--------GL 160

  Fly   137 ERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVP 201
            :.||.|:.|:|..:|:.|:....:|.....:|.||.|.||||.|:|...:|....|.:...:...
  Fly   161 KEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEM 225

  Fly   202 VQMMAQMGTFRANYFRDLDAQVIELPY---------------LNSNLSMTIFLP--------REV 243
            |.||.:.|.|:......|.:|:|:|||               ..|::||.|.||        |.:
  Fly   226 VYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVI 290

  Fly   244 EGLSALEEKIVGFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSG 308
            ..|:|...| ..|.|.|..| :.|.||||:.|.|.||...|..:|:..:||..:....|.||...
  Fly   291 SRLNADSVK-KWFERALPQK-IELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPIS 353

  Fly   309 GKVSQVSHKAFLEVNEEGAEAAGATSVAV--TNRAGFSTFLMADHPFAFVIRD--ANTIYFQGRV 369
            ..:....|.|.::|:|.|:.||.||.:.|  ::|....|....:|||.|:|.|  .:||.|.|..
  Fly   354 LVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVY 418

  Fly   370 VSP 372
            ..|
  Fly   419 SDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 117/388 (30%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 117/388 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446257
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.