DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPINA2

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_006211.2 Gene:SERPINA2 / 390502 HGNCID:8985 Length:421 Species:Homo sapiens


Alignment Length:372 Identity:102/372 - (27%)
Similarity:178/372 - (47%) Gaps:19/372 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP-SEDKEA 73
            ||.:|....||:..|...|    |::|:|.|:....:|:.:|.:..|..|:...|.:. :|..||
Human    57 VTDLAFDLYKELADLSQTS----NVLVTPTSVAMAFAMLSLGTKADTRTEILEGLNVNLTETPEA 117

  Fly    74 -VAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAE 137
             :...:..:|..|...:....|...:.::||....|...:....::.:.|||.||:..:...|.|
Human   118 KIHECFQQVLQALSRPDTRLQLTTGSSLFVNKSMKLVDTFLEDTKKLYHSEASSINFRDTEEAKE 182

  Fly   138 RINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPV 202
            :||.:|..:|..|:..::.  .:..|....||:.|.|.|:|:.||.........|.|.....:.|
Human   183 QINNYVEKRTGRKVVDLVK--HLKKDTSLALVDYISFHGKWKDKFKAEHIMVEGFHVDDKTIIRV 245

  Fly   203 QMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIV-----GFARPLVA 262
            .|:..:|.|..:..|:|.:.|:...|: .|.:....|| :.:.:..||||:.     ...|....
Human   246 PMINHLGRFDIHRDRELSSWVLAQHYV-GNATAFFILP-DPKKMWQLEEKLTYSHLENIQRAFDI 308

  Fly   263 KEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGA 327
            :.:.|..||..|....:||..|..|||.::|::::||||: :.::..|:|:..|.|.|.::|:|.
Human   309 RSINLHFPKLSISGTYKLKRVLRNLGITKIFSNEADLSGV-SQEAPLKLSKAVHVAVLTIDEKGT 372

  Fly   328 EAAGATSVAVTNRAGFSTFLMADHPFAFVIRD--ANTIYFQGRVVSP 372
            ||.||..:.....:.:.| :|.:.||..:|:|  .|...|.|:||:|
Human   373 EATGAPHLEEKAWSKYQT-VMFNRPFLVIIKDDITNFPLFIGKVVNP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 96/361 (27%)
SERPINA2NP_006211.2 SERPIN 62..418 CDD:214513 98/365 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.