DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpinb3b

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_941373.1 Gene:Serpinb3b / 383548 MGIID:2683293 Length:387 Species:Mus musculus


Alignment Length:377 Identity:139/377 - (36%)
Similarity:214/377 - (56%) Gaps:27/377 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGL------------PSEDKE 72
            |:|:.|.:|  ::|:..||:|:.|.|:|:.:||:|:|..:::..|..            ..:|:|
Mouse    14 EMYRQLRES--DKNIFYSPISMMTALAMLQLGAKGNTEIQIEKVLQFIETTKKTTEKSEHCDDEE 76

  Fly    73 AVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAE 137
            .|..::..|:..|....:...||.||.||....:...|.:...::|.::::.||:...:....:|
Mouse    77 NVHEQFQKLITQLNKSNDDYDLKAANSIYGAKGFPFLQTFLEDIKEYYQAKVESLDFEHATEESE 141

  Fly   138 -RINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVP 201
             :||.||..:|:||||.:...||::|....:||||:||||||..||:...||...|.:..|.|.|
Mouse   142 KKINSWVESKTNGKIKDLFPSGSLSSSTILVLVNAVYFKGQWNRKFNENHTREEKFWLNKNTSKP 206

  Fly   202 VQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVG-------FARP 259
            ||||.|...|..::..|:.||::|:||...:|||.:.||.|::||..|||::..       .|..
Mouse   207 VQMMKQRNKFNFSFLGDVHAQIVEIPYKGKDLSMFVLLPMEIDGLKQLEEQLTTDKLLEWIKAEN 271

  Fly   260 LVAKEVYLKLPKFKIEFRDELKETLEKLGIRELF-TDKSDLSGLFADKSGGKVSQVSHKAFLEVN 323
            :...|:||.||:||:|.:.:|:..||.:|:.:.| ..|:|.||: :...|..||:|.||:|:|||
Mouse   272 MHLTELYLSLPRFKVEEKYDLQVPLEHMGMVDAFDPQKADFSGM-SSIPGLVVSKVLHKSFVEVN 335

  Fly   324 EEGAEAAGATSVAVTNR-AGFSTFLMADHPFAFVI--RDANTIYFQGRVVSP 372
            |||.|||.||.|.|:.| |..:.....||||.|.|  |..|:|.|.||:.||
Mouse   336 EEGTEAAAATGVEVSVRSAQIAEDFCCDHPFLFFIIHRMTNSILFFGRICSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 136/372 (37%)
Serpinb3bNP_941373.1 SERPIN 6..387 CDD:294093 137/375 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.