DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpinb3c

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_958751.2 Gene:Serpinb3c / 381286 MGIID:1277952 Length:386 Species:Mus musculus


Alignment Length:376 Identity:132/376 - (35%)
Similarity:204/376 - (54%) Gaps:26/376 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL------------GLPSEDKE 72
            |:|:.|.:|  ::|:..||:|:.|.|.|:.:||:|:|..:::..|            ....:|::
Mouse    14 EMYRQLRES--DKNIFYSPISMITALGMLKLGAKGNTEIQIEKVLQCNETTEKTTEKSAHCDDED 76

  Fly    73 AVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAE 137
            .|..::..|:..|....:...||.||.||....:.|.|.:...::|.:.:..||:...:....:|
Mouse    77 NVHEQFQKLITQLNKSNDDYDLKAANSIYGAKGFPLLQTFLEDIKEYYHANVESLDFEHAAEESE 141

  Fly   138 -RINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVP 201
             :||.||.::|:||||.:...||::|..|.:||||:||||:|..|||...|....|.:..|.|:|
Mouse   142 KKINFWVKNETNGKIKDLFPSGSLSSSTKLVLVNAVYFKGRWNHKFDENNTIEEMFWLNKNTSIP 206

  Fly   202 VQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVGF-------ARP 259
            |.||.|...|..::..|:.||::|:||....|||.:.||.|::||..||:::...       |..
Mouse   207 VPMMKQRNKFMFSFLEDVQAQIVEIPYKGKELSMFVLLPMEIDGLKQLEKQLTAAKLLEWTRAEN 271

  Fly   260 LVAKEVYLKLPKFKIEFRDELKETLEKLGIRELF-TDKSDLSGLFADKSGGKVSQVSHKAFLEVN 323
            :...|:||.||:||:|.:.:|...||.:|:...| ..|:|.||: :...|..||:|.||:|:|||
Mouse   272 MHLTELYLWLPRFKVEEKYDLPVPLECMGMVNAFDPQKADFSGM-SSTQGLVVSKVLHKSFVEVN 335

  Fly   324 EEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVI--RDANTIYFQGRVVSP 372
            |||.||..|:...|..|.........||||.|.|  ...|:|.|.||:.||
Mouse   336 EEGTEADPASGEEVILRLAQVADFRCDHPFLFFIIHSKTNSILFFGRISSP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 129/371 (35%)
Serpinb3cNP_958751.2 SERPIN 6..386 CDD:294093 130/374 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 216 1.000 Domainoid score I2692
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3582
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.