DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina11

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001008776.1 Gene:Serpina11 / 362774 RGDID:1359239 Length:462 Species:Rattus norvegicus


Alignment Length:418 Identity:105/418 - (25%)
Similarity:191/418 - (45%) Gaps:63/418 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAV 74
            ||......:..:|:.|::.... |::.||||:.:.::::.:||...|..::..:||....:..|.
  Rat    50 VTPTITNFALRLYKQLAEEIPG-NILFSPVSLSSTVALLSLGAHADTQAQILQSLGFNLTETPAA 113

  Fly    75 AARYG--ALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAE 137
            ....|  :||:.|........|||.:.::::.|....|.:..:.:|.:.:.|.|.:.|......:
  Rat   114 DIHRGFQSLLHTLDLPSPKLELKLGHSLFLDRQLKPQQRFLDSAKELYGALAFSANFTEAAATGQ 178

  Fly   138 RINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTR-ASTFQVTANKSVP 201
            :||..|..||.|::.|.:.  ....|...:|:|.|:||.:|:..||..:|| ..:|.|.....:.
  Rat   179 QINDLVRKQTYGQVVGCLP--EFDRDTLMVLLNYIFFKAKWKHPFDRYQTRKQESFFVDQRLQLR 241

  Fly   202 VQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTI-------------------------FLPR 241
            :.||.|....|..|.::....|:::.|..:.|.:.:                         ||||
  Rat   242 IPMMRQKEMHRFLYDQEASCTVLQIEYSGTALLLLVLPDPGKMQQVEAALQPETLRRWGQRFLPR 306

  Fly   242 EVE----GLSALE-EKIVGFARPLVAK-------------EVYLKLPKFKIEFRDELKETLEKLG 288
            :.:    |...|. :::..|.:..|.|             .:.|.||:|.:.....|:|.|..:|
  Rat   307 KAQAGGAGNGGLHWDRVNEFPQNRVGKLSLKHLQMTQTWSLLDLHLPRFSVSATYNLEEILPLVG 371

  Fly   289 IRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGAT-------SVAVTNRAGFSTF 346
            :..||..::||||:.. :....||:|||||.:::||:|.|||.|:       |:.:|: |..:.|
  Rat   372 LSSLFDVEADLSGIMG-QLNKTVSRVSHKAVVDMNEKGTEAAAASGLLSQPPSLNMTS-APHAHF 434

  Fly   347 LMADHPFAFVIRDANT--IYFQGRVVSP 372
               :.||..::.:..|  :.|.|:||:|
  Rat   435 ---NRPFLLLLWEVTTQSLLFLGKVVNP 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 100/407 (25%)
Serpina11NP_001008776.1 alpha-1-antitrypsin_like 53..456 CDD:239011 100/410 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.