DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and CG43366

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster


Alignment Length:332 Identity:79/332 - (23%)
Similarity:124/332 - (37%) Gaps:85/332 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLNDLQGQEEG 91
            |..:.::||:||.::.::|||||:||.|||:.|:...|.|   |.......:....|.....|:.
  Fly  1701 KISSARSLVISPFALTSMLSMVFLGARGSTSGEMNEILKL---DDMVTFNPHLIFKNITNSVEQA 1762

  Fly    92 PILKLANRIYVNDQYSLNQNYNLAVREPFKSE------AESISLTN----GPVAAERINQWVLDQ 146
            ....:|...:|.:.:|...|..:.   ||..|      |..:...|    ..:...|.|..|...
  Fly  1763 SDSDIATAAFVREIFSDRANGKIL---PFFKEKTQQLYAGHVEEVNFHVVNDIVRRRTNLLVKRH 1824

  Fly   147 TSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKT-RASTFQ----------------- 193
            |.||:            ::.|..|:::..|       |..| .|:.||                 
  Fly  1825 TMGKV------------LEYLRTNSVWVNG-------PLATISANLFQTDCSHGSTTDRDGEMFF 1870

  Fly   194 -----VTANKSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLP------REVEGLS 247
                 |...:.||:..:.....|.|.|...|||.|:....:.:.:|....:|      ..::.|.
  Fly  1871 QVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQSSISPMDNLD 1935

  Fly   248 ALEEKIVGFA----------------RPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELF-TD 295
            .||..:|..|                ||  ..||  :||:|...........|:|:|:|.|| :|
  Fly  1936 RLERSLVETAFSDKQAWRRLLTSLMDRP--GMEV--QLPRFSHRSFVNASLGLQKMGLRGLFKSD 1996

  Fly   296 KSDLSGL 302
            .:||.||
  Fly  1997 FADLRGL 2003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 79/332 (24%)
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 79/332 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.