DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Spn28Dc

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster


Alignment Length:414 Identity:105/414 - (25%)
Similarity:171/414 - (41%) Gaps:87/414 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLNDLQ------------- 86
            :.||:||...|:::.:||:|.:.:||.:...:|  |...:..::|.:|.|||             
  Fly   130 IYSPLSIVHSLALLLLGAKGRSYEELSTVFDIP--DTSRLHEQFGLMLQDLQQPTREAISAGRPL 192

  Fly    87 ------------------GQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGP 133
                              |..|   :.|||.::....|:||.:|...:.|.:.|:.:.......|
  Fly   193 TDWRASSAMRSNRRAQRPGAHE---VHLANGLFTQTGYTLNPDYRRVIVEVYASDLQIQDFEGSP 254

  Fly   134 VAAE-RINQWVLDQTSGKIKGMIDPGSMTSDV----KALLVNAIYFKGQWESKFDPAKTRASTFQ 193
            ..|. .||.:|...|...|:.:|     .||:    :.:|.||:|||..||:.|..:.||...|.
  Fly   255 ATARYNINAYVAQHTKNHIENII-----ASDIPQTTRMILANALYFKAFWETDFIESATRPDNFY 314

  Fly   194 VTANKSVP---VQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLP--REVEGLSALE--- 250
            .....:.|   |||||..|.:..:...:|..::|.|||..:..:|.|..|  ..|..|.||:   
  Fly   315 PNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQPFKSSVRELMALQKRL 379

  Fly   251 --EKIVGFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTD-KSDLS------------ 300
              :||......:..:...:..||..:.....||..::::|:..:|:. ::|||            
  Fly   380 TADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEATRTNA 444

  Fly   301 -------GLFADKSGGK--------VSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMAD 350
                   .|.|.:..|.        |..:.||....|||:|.||| |:||....::|.......|
  Fly   445 LGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAA-ASSVTYLKKSGPDVLFRGD 508

  Fly   351 HPFAFVIRDANT--IYFQGRVVSP 372
            .||..::|...|  :.|.|.:..|
  Fly   509 TPFMVLVRHDPTKLVLFYGLINEP 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 104/409 (25%)
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 103/407 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
33.010

Return to query results.
Submit another query.