DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina7

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_808588.3 Gene:Serpina7 / 331535 MGIID:3041197 Length:426 Species:Mus musculus


Alignment Length:378 Identity:107/378 - (28%)
Similarity:185/378 - (48%) Gaps:26/378 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAA 76
            |:....:..:|:.||..:.:.|:..|||||...|:|:..|:..||..::...||....|......
Mouse    55 SINADFAFSLYRRLSVENPDLNIFFSPVSISVALAMLSFGSGSSTQTQILEVLGFNLTDTPVTEL 119

  Fly    77 RYG-----ALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAA 136
            :.|     ..||..:.:.|   |::.|.:::..|......:...|:..:::|..|...:|...|.
Mouse   120 QQGFQHLICSLNFPKNELE---LQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQ 181

  Fly   137 ERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKT-RASTFQVTANKSV 200
            .:||.:|..||.|||.|:|.  .:..::..:|||.|:|:.||.:.|..:|| .:|.|.|..:.:|
Mouse   182 HKINSYVEKQTKGKIVGLIQ--GLKLNIIMILVNYIHFRAQWANPFRVSKTEESSNFSVDKSTTV 244

  Fly   201 PVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPRE-----VEGLSALEEKIVGFARPL 260
            .|.||.|:..:......:|:..|:::.|..:.|::.: ||:|     ||  :|:..|.:.....|
Mouse   245 QVPMMHQLEQYYHYVDMELNCTVLQMDYSENALALFV-LPKEGHMEWVE--AAMSSKTLKKWNYL 306

  Fly   261 VAKE-VYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNE 324
            :.|. |.|.:|||.|....:|..||:|:|:|:.|.:.:|..|:..| ||.|:|...|||.|.:.|
Mouse   307 LQKGWVELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITED-SGLKLSYAFHKAVLHIGE 370

  Fly   325 EGAEAAGATSVAVTNR---AGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372
            ||.:...:..|...::   ......:..|..|..:|.:..|  :.|.|::|:|
Mouse   371 EGTKEGASPEVGSLDQQEVPPLHPVIRLDRAFLLMILEKRTRSVLFLGKLVNP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 104/369 (28%)
Serpina7NP_808588.3 alpha-1-antitrypsin_like 57..419 CDD:239011 103/370 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.