DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and serpina1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_017207927.1 Gene:serpina1 / 322701 ZFINID:ZDB-GENE-030131-1421 Length:433 Species:Danio rerio


Alignment Length:363 Identity:109/363 - (30%)
Similarity:188/363 - (51%) Gaps:19/363 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IYQLLSKSHTNQ--NLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLN 83
            :|:.|:.:...|  |:..|||.|...||::.:||:.||..::.|.||..:...|.|...|..||:
Zfish    77 LYKKLASNPDGQGKNIFFSPVGISMALSLLAVGAKASTLSQIYSGLGYSALTPEQVNEGYEHLLH 141

  Fly    84 DLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTS 148
            .|...::...|:....:.:.|.:.:...:....:..:.|||..:..:...:||..||:::..:|.
Zfish   142 MLGHSQDAMQLEAGAGVAIRDGFKVVDQFLKDAQHYYNSEAFGVDFSKPEIAAAEINKFIARKTH 206

  Fly   149 GKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRA 213
            .||..|:.  .:.:|...:|:|.:||:|:||..||...|..:.|:|..:.:|.|.||.:.|  |.
Zfish   207 DKITNMVK--DLDADTVMMLINYMYFRGKWEKPFDAKLTHKADFKVDQDTTVQVDMMKRTG--RY 267

  Fly   214 NYFRDLDAQ--VIELPYLNSNLSMTIFLPREVEGLSALEEKIV-----GFARPLVAKEVYLKLPK 271
            :.::|...|  |:.:|| ..|.||.|.||.:.: :..|||.|.     .:...|....|.|.:||
Zfish   268 DIYQDPVNQTTVMMVPY-KGNTSMMIVLPDDGK-MKELEESICRHHLKNWHDKLFRSSVDLFMPK 330

  Fly   272 FKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVA 336
            |.|....:|...|:.:|:.:.|.||:|.||: .::...|||||.|:|.:.|:|:|.|||..|::.
Zfish   331 FSISATSKLDGILKDMGMTDAFNDKADFSGM-TEEVKVKVSQVLHQAVMSVDEKGTEAAAITTIE 394

  Fly   337 VTNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372
            :...:...|.:: :.||..:|.:.:|  |.|.|::.:|
Zfish   395 IMPMSLPDTVIL-NRPFLVLIVEDSTMSILFMGKITNP 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 108/358 (30%)
serpina1XP_017207927.1 alpha-1-antitrypsin_like 69..428 CDD:239011 108/358 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.