DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpine3

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:397 Identity:107/397 - (26%)
Similarity:178/397 - (44%) Gaps:79/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWVTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSED-- 70
            ||:  :..:.:..:|:..:......|.|:||.|:...|.::..||.|:|..:|..|||...:|  
Mouse    28 LWL--LKTEFALHLYRSAAAERNGTNFVISPASVSLSLEILQFGARGNTGWQLAGALGYTVQDPR 90

  Fly    71 -KEAVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPV 134
             ||.:.|.|....|..||..    ::||..:::....||:                       |.
Mouse    91 VKEFLHAVYTTRHNSSQGVG----MELACTLFMQTGTSLS-----------------------PC 128

  Fly   135 AAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQ----WESKFDPAKTRAS----- 190
            ..|::::|.  .:|.:.....:|.|.|::...:.......:|.    | .:.|...|:.|     
Mouse   129 FVEQVSRWA--NSSLEAADFSEPNSTTTEASKVTSRQSTGEGPDSPLW-GRADALSTQLSIMSTM 190

  Fly   191 TFQVTANK--SVPVQ---------------MMAQMGTFRANYFRDL---DAQVIELPYLNSNLSM 235
            |||.|..|  ||.:|               .|.|:.......|:|.   :..|:||.||....|:
Mouse   191 TFQSTWQKRFSVVLQPLPFTHAHGLVLQVPAMHQVAEVSYGQFQDAAGHEIAVLELLYLGRVASL 255

  Fly   236 TIFLPREVEG--LSALEEKIVGFARPLVAKEVYLK-------LPKFKIEFRDELKETLEKLGIRE 291
            .:.||:: :|  |..:|..:.  ||.|......||       ||:|||:.:.::|..|...||.:
Mouse   256 LLVLPQD-KGTPLDHIEPHLT--ARVLHLWTTRLKRARMDVFLPRFKIQNQFDVKSILRSWGITD 317

  Fly   292 LFTD-KSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAF 355
            ||.. |::|.|: :.:.|..|||::|||.:|::|||..::.||:|.:..|:..|.| .||.||.|
Mouse   318 LFDPLKANLKGI-SGQDGFYVSQLTHKAKMELSEEGTRSSAATAVLLLRRSRTSAF-KADRPFIF 380

  Fly   356 VIRDANT 362
            ::|:.:|
Mouse   381 LLREHST 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 105/389 (27%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 107/397 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.