DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and RGD1562844

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001333297.1 Gene:RGD1562844 / 306892 RGDID:1562844 Length:296 Species:Rattus norvegicus


Alignment Length:266 Identity:91/266 - (34%)
Similarity:139/266 - (52%) Gaps:16/266 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAE----RINQ 141
            |...|...|....|::||.|:|:....:...:..:....:.||.|.:|...   |||    .:|.
  Rat    23 LFKKLNKSERYFSLRMANGIFVDKTCEVLPTFKESCLRFYNSEMEQLSFAE---AAEESRKHVNT 84

  Fly   142 WVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMA 206
            ||..||.|||..::...|:....:.:||||:|.|..|..:||...||...|::..|::.|||||.
  Rat    85 WVSKQTEGKIPELLPDDSVDFQTRLVLVNALYLKATWGRQFDEGSTREMPFKINKNETRPVQMMY 149

  Fly   207 QMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGFARP--LVAKE 264
            |.|.|...|.:::.|.::.:||....|...:.||.|...:|.:|     ||:..:.:|  :....
  Rat   150 QEGIFCYKYVKEVPASLLMIPYKGDELCFLVLLPDESVDISKVEEELTFEKLTAWTQPDTMSYTH 214

  Fly   265 VYLKLPKFKIEFRDELKETLEKLGIRELFTD-KSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAE 328
            |.:.|||||:|...:||..|::|||.:.|.: |:|||.: |.:....||:..||:.:||||:|.|
  Rat   215 VEVFLPKFKLEEDYDLKSLLQRLGIVDAFEETKADLSAM-APERNLCVSKFVHKSVVEVNEKGTE 278

  Fly   329 AAGATS 334
            ||.|.|
  Rat   279 AAAAAS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 91/266 (34%)
RGD1562844NP_001333297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm12319
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.