DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPIND1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_000176.2 Gene:SERPIND1 / 3053 HGNCID:4838 Length:499 Species:Homo sapiens


Alignment Length:377 Identity:104/377 - (27%)
Similarity:187/377 - (49%) Gaps:42/377 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IYQLL-SKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAAR------- 77
            :|::| .:.:|..|:.::||.|.|.:.|:.:|.:|.|.:::.|.|..    |:.|.|.       
Human   137 LYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSILHF----KDFVNASSKYEITT 197

  Fly    78 ----YGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAER 138
                :..|.:.|..:..|..|:..|.:|:..|:.:..::...|||.:.:||: |:..:.|....:
Human   198 IHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYYFAEAQ-IADFSDPAFISK 261

  Fly   139 INQWVLDQTSGKIKGM---IDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSV 200
            .|..::..|.|.||..   |||.:     :.:::|.|||||.|.:||....|....|::...:.|
Human   262 TNNHIMKLTKGLIKDALENIDPAT-----QMMILNCIYFKGSWVNKFPVEMTHNHNFRLNEREVV 321

  Fly   201 PVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIV-----GFARPL 260
            .|.||...|.|.|...::||..:::|.|: ..:||.|.:|.::.|:..||.::.     .:.:.:
Human   322 KVSMMQTKGNFLAANDQELDCDILQLEYV-GGISMLIVVPHKMSGMKTLEAQLTPRVVERWQKSM 385

  Fly   261 VAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEE 325
            ..:...:.|||||:|....|.|:|:.:|||.||....:::|:...:..  :....|:..:.||||
Human   386 TNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDKNGNMAGISDQRIA--IDLFKHQGTITVNEE 448

  Fly   326 GAEAAGATSVA---VTNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372
            |.:|...|:|.   ::.:..|:    .|.||.|:|.:..|  :.|.|||.:|
Human   449 GTQATTVTTVGFMPLSTQVRFT----VDRPFLFLIYEHRTSCLLFMGRVANP 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 101/372 (27%)
SERPIND1NP_000176.2 HCII 62..497 CDD:239002 104/377 (28%)
Chemotactic activity 68..79
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 73..97
Glycosaminoglycan-binding site 192..212 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.