DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and LOC299282

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001376144.2 Gene:LOC299282 / 299282 RGDID:3745 Length:413 Species:Rattus norvegicus


Alignment Length:372 Identity:117/372 - (31%)
Similarity:192/372 - (51%) Gaps:35/372 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL--GLPSEDKEAVAARYGALLN 83
            :|:.|:..:.::|:|.||:||...|:::.:||:.||.:|:...|  .|....:|.:...:|.||.
  Rat    56 LYKKLALRNPDKNVVFSPLSISAALTILSLGAKDSTMEEILEGLKFNLTEITEEEIHQGFGHLLQ 120

  Fly    84 DLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTS 148
            .|...|:...:...:.::::.:..:...:....|..:::||..........|.:.||.:|.:||.
  Rat   121 RLSQPEDQVEINTGSALFIDKEQPILSEFQEKTRALYQAEAFIADFKQPNEAKKLINDYVSNQTQ 185

  Fly   149 GKIKGMIDPGSMTSDVK----ALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMG 209
            |||      ..:.||::    .:|||.:.|||:|:..|:|..|..|.|.:...:||.|.|| ::.
  Rat   186 GKI------AELFSDLEERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDEKRSVKVPMM-KIK 243

  Fly   210 TFRANYFRD--LDAQVIELPYLNSNLSMTIFLP-----REVEGLSALE-EKIVGFARPLVAKEVY 266
            .....|.||  |...|:||.| ..|.|....||     ::||  |:|: |.:..:...|:.:.:.
  Rat   244 EVTTPYVRDEELSCSVLELKY-TGNASALFILPDQGKMQQVE--SSLQPETLKKWKDSLIPRIIN 305

  Fly   267 -LKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGK---VSQVSHKAFLEVNEEGA 327
             |::|||.|.....|||.|.:|||:::|:.::|||.:    :|.|   ||||.|||.|:|:|.|.
  Rat   306 DLRMPKFSISTDYSLKEVLPELGIKKVFSQQADLSRI----TGTKDLYVSQVVHKAVLDVDETGT 366

  Fly   328 EAAGATSVAVTNRAGFSTFLMADHPFAFVI--RDANTIYFQGRVVSP 372
            ||..||.||...|....| |..:.||..||  .|:.:|.|..::.:|
  Rat   367 EATAATGVATVIRRQPRT-LNFNRPFMVVITDMDSQSILFVAKITNP 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 116/367 (32%)
LOC299282NP_001376144.2 serpinA3_A1AC 36..413 CDD:381019 117/372 (31%)
RCL 365..389 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.