DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina3m

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001257911.1 Gene:Serpina3m / 299276 RGDID:735068 Length:419 Species:Rattus norvegicus


Alignment Length:384 Identity:118/384 - (30%)
Similarity:193/384 - (50%) Gaps:31/384 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWVTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL--GLPSED 70
            |.:.|:....:..:|::|:..:.::|:|.||:||...|::|.:||:|:|.:|:...|  .|....
  Rat    45 LTLESINTDFAFSLYKMLALKNPDKNVVFSPLSISAALAIVSLGAKGNTLEEILEVLRFNLTESY 109

  Fly    71 KEAVAARYGALLNDLQGQEEGPILKL--ANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGP 133
            :..:...:|.||..|  .:.|..:|:  .|.::::....:...:....|..::.||.:.......
  Rat   110 ETDIHQGFGHLLQRL--SQPGDQVKIITGNALFIDKNLQVLAEFQEKTRALYQVEAFTADFQQPR 172

  Fly   134 VAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANK 198
            |..:.||.:|.:||.|||:.::  ..:......:|||.:.|:|:|:..|||..|..|.|.|...:
  Rat   173 VTEKLINDYVRNQTQGKIQELV--SGLKERTSMVLVNYLLFRGKWKVPFDPDYTFESEFYVDEKR 235

  Fly   199 SVPVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLP-----REVEGLSALE--EKIV 254
            ||.|.|| ::......||||  |...|:||.| ..|.|....||     ::||.....|  :|..
  Rat   236 SVKVSMM-KIEELTTPYFRDEELSCSVLELKY-TGNSSALFILPDKGRMQQVEASLQPETLKKWK 298

  Fly   255 GFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGK---VSQVSH 316
            ...||....|:|  ||:..|.....|:|.|.:||||::|:.::|||.:    :|.|   ||||.|
  Rat   299 DSLRPRKIDELY--LPRLSISTDYSLEEVLPELGIRDVFSQQADLSRI----TGAKDLSVSQVVH 357

  Fly   317 KAFLEVNEEGAEAAGATSVAVTNRAGFSTFLM-ADHPFAFVIRDAN--TIYFQGRVVSP 372
            |..|:|||.|.|||.||...:..|:|....:: .:.||...:...:  ||.|..:|::|
  Rat   358 KVVLDVNETGTEAAAATGANLVPRSGRPPMIVWFNRPFLIAVSHTHGQTILFMAKVINP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 114/371 (31%)
Serpina3mNP_001257911.1 SERPIN 56..416 CDD:214513 115/371 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.