DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina16

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_853661.2 Gene:Serpina16 / 299271 RGDID:727888 Length:415 Species:Rattus norvegicus


Alignment Length:382 Identity:98/382 - (25%)
Similarity:165/382 - (43%) Gaps:62/382 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP---SEDKEAVAARYGALL 82
            :|:.|.:....:||:.||:.|...|.::....:.....::...||..   :.|.:| |:.||.||
  Rat    55 LYKQLPQPKRGKNLIFSPLGIIVPLVLLAFQDKPKARHQVLQDLGFTVTGALDTKA-ASEYGKLL 118

  Fly    83 NDLQ-----GQEEGPIL-------------KLANRIYVNDQYSLNQNYNLAVREPFKSEAESISL 129
            ::|.     |...|.:|             ||||..|         |.|:.:          ||.
  Rat   119 SNLLHTKNCGIYTGSLLFIDKTLKPAKTFVKLANSSY---------NSNVVL----------ISF 164

  Fly   130 TNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQV 194
            .|..:|.::|:..:..:|.|||..::  ..:.......|.|..:|||:|:..|:...||...|.:
  Rat   165 GNYGLAQKQIDLAIRARTHGKITKLL--RILKPPTNLFLANYNFFKGKWKYPFNRKHTRMRYFWL 227

  Fly   195 TANKSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPR----EVEGLSALEEKIVG 255
            .......|.||.::|.|:..||..:.:.|::||: ..::|...|||.    |....:.||:....
  Rat   228 EDGTKTLVPMMQRVGWFQLQYFSQMHSYVLQLPF-TCSISGVFFLPDDGKFEESEKALLEQSFET 291

  Fly   256 FARPLVAKEVYLKLPKFKIEFR---DELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHK 317
            :.:|....:.:|..|||.|...   :.||.....:   :||::..|||.:...|:...||...|:
  Rat   292 WIQPFPMSKRWLFFPKFSIPVALHLENLKHVNSNI---KLFSEHMDLSRITLQKAPLTVSTAVHR 353

  Fly   318 AFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRD--ANTIYFQGRVVSP 372
            ..|.|||:|.|...:..     ....:| |..:..|..:|.|  :|::.|.|:||:|
  Rat   354 VELTVNEDGEEKDESQP-----EPDLAT-LHFNRSFLLLILDETSNSLLFMGKVVNP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 95/377 (25%)
Serpina16NP_853661.2 serpinA16_HongrES1-like 40..406 CDD:381053 98/382 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.