DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serping1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_954524.1 Gene:Serping1 / 295703 RGDID:735225 Length:504 Species:Rattus norvegicus


Alignment Length:384 Identity:101/384 - (26%)
Similarity:172/384 - (44%) Gaps:65/384 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SKEIYQLLS---KSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYG 79
            |.::|...|   |:.|  |:..||.||.::|:.|.:||..||...|:..|..|.:        :.
  Rat   155 SVKLYHAFSATKKAET--NMAFSPFSIASLLTQVLLGAGDSTKSNLEDILSYPKD--------FA 209

  Fly    80 ALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISL---------TNGPVA 135
            .:...|:......:..::...:..|         ||:|:.:.:  .|:||         .:|...
  Rat   210 CVHQTLKAFSSKGVTSVSQIFHSPD---------LAIRDTYVN--ASLSLYGSSPRVLGPDGDAN 263

  Fly   136 AERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSV 200
            .:.||.||.:.|:.||..::|  |:.||.:.:|:||:|...:|:..|:..|..||.  :..|..:
  Rat   264 LKLINTWVAENTNHKINELLD--SLPSDTRLVLLNAVYLSAKWKKTFEQKKMMASF--LYKNSMI 324

  Fly   201 PVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLPRE-VEGLSALEEKIVGFARPLVA 262
            .|.|::.. .:....|.|  |.|:|.:| .|:.|||..|.:|:. ...|..:|:.:    .|.|.
  Rat   325 KVPMLSSK-KYPLALFNDQTLKAKVGQL-QLSHNLSFVIMVPQSPTHQLEDMEKAL----NPTVF 383

  Fly   263 KEV------------YLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVS 315
            |.:            |:.:|:.|::...::...:|||...: ||...:|.||..|.. .:||.:.
  Rat   384 KAILKKLELSKFQPTYVMMPRIKVKSSQDMLSIMEKLEFFD-FTYDLNLCGLTEDPD-LQVSSMK 446

  Fly   316 HKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDANTIY--FQGRVVSP 372
            |:..||:.|.|.|||.|::::|....   .......||.|::.|....:  |.|||..|
  Rat   447 HETVLELTETGVEAAAASTISVARNL---LIFEVQQPFLFLLWDQRHKFPVFMGRVYDP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 98/379 (26%)
Serping1NP_954524.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..132
SERPIN 150..499 CDD:294093 98/379 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.