DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpinh1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_058869.2 Gene:Serpinh1 / 29345 RGDID:69302 Length:417 Species:Rattus norvegicus


Alignment Length:374 Identity:106/374 - (28%)
Similarity:178/374 - (47%) Gaps:40/374 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLNDL 85
            :||.::|....:|:::||:.:.:.|.:|.:|.:.:||.:.::.|.......|.|....|.||..|
  Rat    53 LYQAMAKDQAVENILLSPLVVASSLGLVSLGGKATTASQAKAVLSAEKLRDEEVHTGLGELLRSL 117

  Fly    86 QGQEEGPIL-KLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTSG 149
            .......:. ||.:|:|.....|...::..:.::.:..|...|:..:...|.:.||:|....|.|
  Rat   118 SNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINEWASQTTDG 182

  Fly   150 KIKGMIDPGSMTSDVK----ALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGT 210
            |:.      .:|.||:    ||||||::||..|:.||.........|.||.:.:|.|.||.:.|.
  Rat   183 KLP------EVTKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMHRTGL 241

  Fly   211 FRANYFRD--LDAQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGFARPLVAKEVYLK 268
            :  ||:.|  ...|::|:|..:...|:.|.:|..||.|..||     |::..:...:..|.|.:.
  Rat   242 Y--NYYDDEKEKLQLVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKTWMGKMQKKAVAIS 304

  Fly   269 LPKFKIEFRDELKETLEKLGIRE-LFTDKSDLSGLFADKSGGK---VSQVSHKAFLEVNEEG--- 326
            |||..:|...:|::.|..||:.| :..:|:|||.:    ||.|   ::.|.|....|.:.||   
  Rat   305 LPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRM----SGKKDLYLASVFHATAFEWDTEGNPF 365

  Fly   327 -AEAAGATSVAVTNRAGFSTFLMADHPFAFVIRD--ANTIYFQGRVVSP 372
             .:..|...:....      ...|||||.|::||  :.::.|.||:|.|
  Rat   366 DQDIYGREELRSPK------LFYADHPFIFLVRDNQSGSLLFIGRLVRP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 103/369 (28%)
Serpinh1NP_058869.2 serpinH1_CBP1 35..416 CDD:381003 106/374 (28%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.