DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpinb6e

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:357 Identity:119/357 - (33%)
Similarity:199/357 - (55%) Gaps:15/357 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEA---VAARYGALLNDLQGQEEG 91
            :::|:..||:|:.:.|||:.:||.|:||.::...|.|.:.:...   ....:.:||.::...:..
  Rat    23 SSKNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGNGGGDFHQCFQSLLTEVNKSDRR 87

  Fly    92 PILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGP-VAAERINQWVLDQTSGKIKGMI 155
            .:||.:|.::|.|.:.:..::..:.|:.:::|.|::.....| .:.:.||.||..:|...|:.::
  Rat    88 HMLKTSNSVFVEDSFEILASFKDSCRKFYEAEIENMDFKGAPEQSRQHINTWVAKKTEDVIRELL 152

  Fly   156 DPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRANYFRDLD 220
            .||::.|:.:.:|:|:.||||.||..|:...||...|:|:.|:...||||.....||..:..|:.
  Rat   153 SPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPFKVSKNEKKIVQMMFNKSNFRTYHVEDIS 217

  Fly   221 AQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGFAR--PLVAKEVYLKLPKFKIEFRD 278
            ..:..||||.:.||:||.||.|...|..:|     ||::.:.|  .:..:||.:.||:||:|...
  Rat   218 TTLALLPYLGNQLSITIMLPDEYVELRTVENQITYEKLIEWTRLENMQEEEVEILLPRFKLEESY 282

  Fly   279 ELKETLEKLGIRELFTD-KSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAG 342
            ::|..|.|||:...|.| ::|.||: :.|.|..:|:|.||:.:||||||.|||..|.:.......
  Rat   283 DMKNVLCKLGMTNAFEDGRADFSGI-SSKPGLFLSKVVHKSVVEVNEEGTEAAAPTEIVTMGSPL 346

  Fly   343 FSTFLMADHPFAFVIRD--ANTIYFQGRVVSP 372
            ....|:|||||.|:|:|  ...|.|.||..||
  Rat   347 SPQCLVADHPFLFLIQDDRNKAILFLGRFSSP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 116/352 (33%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.