DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpinf2

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:374 Identity:120/374 - (32%)
Similarity:188/374 - (50%) Gaps:50/374 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLND 84
            :::.|::::.|:.|||:||:|:...||.:.:||...|.:.||..|.:          ..|:.:..
  Rat    92 DLFSLVAQTSTSSNLVLSPLSVALALSHLALGARNQTLENLQRVLHM----------NMGSCIPH 146

  Fly    85 L-----QGQEEGPILKLANRIY------VNDQYSLNQNYNLAVREPFK-SEAESISLTNGPVAAE 137
            |     |....|.| :||.|||      :.|.: |.|:..|...:|.| :..:...|.|      
  Rat   147 LLSHFCQNLNPGTI-RLAARIYLQKGFPIKDDF-LEQSEKLFGAKPVKLTGRQEEDLMN------ 203

  Fly   138 RINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPV 202
             ||:||.:.|.|||:..:  ..:..:...||:|||:|.|.|.:||||:.|:..:|.:....:|||
  Rat   204 -INKWVKEATEGKIEDFL--SELPDNTVLLLLNAIHFHGFWRTKFDPSLTQKDSFHLDEQFTVPV 265

  Fly   203 QMM-AQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLP-----REVEGLSALEEKIVGFARPLV 261
            .|| ||....|.......:.||...|:.| |:|..:.:|     ...|.|:.|....: :...:.
  Rat   266 AMMHAQSYPLRWFLLEQPEIQVAHFPFQN-NMSFVVIMPTYFGWNVSEVLANLTWDTL-YQPSMR 328

  Fly   262 AKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEG 326
            .|...::|||..:|...:|..||.|||:::|| ...||.|: :|:| ..||.|.|::.:|::|.|
  Rat   329 EKPTKVRLPKLHLEQHLDLVATLSKLGLQDLF-QSPDLRGI-SDQS-LVVSSVQHQSTMELSEAG 390

  Fly   327 AEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDANTI---YFQGRVVSP 372
            .|||.|||.|:| |...|:|.: :.||.|.|.: .||   .|.|.|.:|
  Rat   391 VEAAAATSTAMT-RMSLSSFFL-NRPFIFFIME-ETIGIPLFVGSVRNP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 118/369 (32%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 118/369 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.