DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpinf1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_808788.1 Gene:Serpinf1 / 287526 RGDID:631369 Length:418 Species:Rattus norvegicus


Alignment Length:378 Identity:108/378 - (28%)
Similarity:181/378 - (47%) Gaps:28/378 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTSVACQTSK---EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDK 71
            |..:|...|.   ::|:|.|.:.:..|:::||:|:.|.||.:.:|||..|...:..||.....:.
  Rat    51 VNKLAAAVSNFGYDLYRLRSGAVSTGNILLSPLSVATALSALSLGAEQRTESVIHRALYYDLINN 115

  Fly    72 EAVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGP-VA 135
            ..:.:.|..||..:...|:.  .|.|:||....:..:..::...:.:.:.:...  .||..| :.
  Rat   116 PDIHSTYKELLASVTAPEKN--FKSASRIVFERKLRVKSSFVAPLEKSYGTRPR--ILTGNPRID 176

  Fly   136 AERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSV 200
            .:.||.||..|..|||..  ....|.|.:..||:...||||||.:|||..||....|.:..:::|
  Rat   177 LQEINNWVQAQMKGKIAR--STREMPSALSILLLGVAYFKGQWATKFDSRKTTLQDFHLDEDRTV 239

  Fly   201 PVQMMAQ-MGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREV-EGLSALEEKIVG-----FAR 258
            .|.||:. ....|.....||:.::.:|| |..::|:..|||..| :.|:.:||.:..     ..|
  Rat   240 RVPMMSDPKAILRYGLDSDLNCKIAQLP-LTGSMSIIFFLPLTVTQNLTMIEESLTSEFVHDIDR 303

  Fly   259 PLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELF--TDKSDLSGLFADKSGGKVSQVSHKAFLE 321
            .|...:..|.:||.|:.:..::..:|:.:.::.||  .|.|.::|     ...|::||.|:|..|
  Rat   304 ELKTIQAVLTVPKLKLSYEGDVTNSLQDMKLQSLFESPDFSKITG-----KPVKLTQVEHRAAFE 363

  Fly   322 VNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372
            .|||||..:....:... |..|......:.||.||:||.:|  :.|.||::.|
  Rat   364 WNEEGAGTSSNPDLQPV-RLTFPLDYHLNRPFIFVLRDTDTGALLFIGRILDP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 104/367 (28%)
Serpinf1NP_808788.1 PEDF 40..415 CDD:239007 107/376 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.