DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and HMSD

DIOPT Version :10

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_016881199.1 Gene:HMSD / 284293 HGNCID:23037 Length:217 Species:Homo sapiens


Alignment Length:74 Identity:20/74 - (27%)
Similarity:27/74 - (36%) Gaps:21/74 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 TDVDKQMAALGPDVVDAGARFYDKVLKKNIAIRKLTGEDYYTAKGNVNYMLRQKAAPLTLRKEFF 299
            ||....||..|..|:..    :|           :|.|   .|...::|:|.|....|.:|||..
Human   334 TDYAAGMAMAGAGVISG----FD-----------MTSE---AALAKLSYVLGQPGLSLDVRKELL 380

  Fly   300 QTGYKDYVG 308
            .   ||..|
Human   381 T---KDLRG 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 serpin42Dd-like_insects 12..372 CDD:381070 20/74 (27%)
HMSDXP_016881199.1 serpin 1..>113 CDD:476815
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.