DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpinb10

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_714955.2 Gene:Serpinb10 / 266775 RGDID:628853 Length:397 Species:Rattus norvegicus


Alignment Length:390 Identity:132/390 - (33%)
Similarity:196/390 - (50%) Gaps:35/390 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL----------GLPSED 70
            |.:.|..:.|::|...:|:..||..|.|.|:||::|.:|:||.::...|          |..||.
  Rat    10 QFAVEFSKKLAESAEGRNIFFSPWGISTSLAMVYLGTKGTTAAQMSQVLHFGSIQDFKFGPDSEK 74

  Fly    71 K----------EAVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAE 125
            |          |.:.:.:..|...:.......:||:||||||...|..:..|...::..|.:|.:
  Rat    75 KRKMECHSGKSEEIQSDFQTLTAKILKHGNSYVLKIANRIYVEKTYLFHNKYLEDMKTYFGAEPQ 139

  Fly   126 SISL--TNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTR 188
            |::.  .:|.:..| ||.||..||.|||..::...::.:....:||||:||||.||.:|....|.
  Rat   140 SVNFVEASGQIRKE-INSWVGSQTGGKIPNLLPDDAVDNKTTMVLVNALYFKGTWEHQFSVQNTT 203

  Fly   189 ASTFQVTANKSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKI 253
            ...|::....|.|||||:...:.:..:..:|....::|.|.|...|:.:.||.|||||..||..|
  Rat   204 ERPFRINKTTSKPVQMMSMKQSLQVFHIEELQTIGVQLHYQNREFSLLLLLPEEVEGLKQLERAI 268

  Fly   254 V-------GFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTD-KSDLSGLFADKSGGK 310
            .       ..|..:...||.|.|||||:|...:|:..|..:|:.:.|.. |::.|.:.:::: ..
  Rat   269 TYEKLDKWTSADMMDTYEVQLYLPKFKMEESYDLQSALRDMGMTDAFNQGKANFSNMTSERN-LF 332

  Fly   311 VSQVSHKAFLEVNEEGAEAAGATSVAVTNR-AGFSTFLMADHPFAFVIRD--ANTIYFQGRVVSP 372
            :|.|.||.|||:||||.|||..|...|..| ...|..|.|||||.|:||.  .|||.|.||..||
  Rat   333 LSNVFHKTFLEINEEGTEAAAGTGSEVNFRIKAPSIELNADHPFLFLIRHNVTNTILFYGRFYSP 397

  Fly   373  372
              Rat   398  397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 129/385 (34%)
Serpinb10NP_714955.2 SERPIN 4..397 CDD:294093 130/388 (34%)
Nuclear localization signal. /evidence=ECO:0000250 74..77 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm12319
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.