DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina3c

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_036789.2 Gene:Serpina3c / 24794 RGDID:2972 Length:416 Species:Rattus norvegicus


Alignment Length:383 Identity:122/383 - (31%)
Similarity:197/383 - (51%) Gaps:28/383 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWVTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL--GLPSED 70
            |.:.|:....:..:|:.|:..:.::|:|.||:||...|:::.:||:.||.:|:...|  .|....
  Rat    43 LTLASINTDFTLSLYKKLALRNPDKNVVFSPLSISAALAILSLGAKDSTMEEILEGLKFNLTEIT 107

  Fly    71 KEAVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVA 135
            :|.:...:|.||..|...|:...:...:.::::.:..:...:....|..:::||..........|
  Rat   108 EEEIHQGFGHLLQRLSQPEDQAEINTGSALFIDKEQPILSEFQEKTRALYQAEAFVADFKQCNEA 172

  Fly   136 AERINQWVLDQTSGKIKGMI-DPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKS 199
            .:.||.:|.:||.|||..:. |....||.|   |||.:.|||:|:..|:|..|..|.|.:...:|
  Rat   173 KKFINDYVSNQTQGKIAELFSDLDERTSMV---LVNYLLFKGKWKVPFNPNDTFESEFYLDEKRS 234

  Fly   200 VPVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLP-----REVEGLSALE----EKI 253
            |.|.|| ::......|.||  |...|:||.| ..|.|....||     ::||  |:|:    :|.
  Rat   235 VKVPMM-KIKDLTTPYVRDEELSCSVLELKY-TGNASALFILPDQGKMQQVE--SSLQPETLKKW 295

  Fly   254 VGFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKA 318
            ....||.:..|  |::|||.|.....|:|.|.:||||::|:.::|||.:...|: ..||||.|||
  Rat   296 KDSLRPRIISE--LRMPKFSISTDYNLEEVLPELGIRKIFSQQADLSRITGTKN-LHVSQVVHKA 357

  Fly   319 FLEVNEEGAEAAGATSVAVTNRAGFST--FLMADHPFAFVIRDAN--TIYFQGRVVSP 372
            .|:|:|.|.|.|.||:|....::...|  .|..:.||..||.|.|  :::|.|:|.:|
  Rat   358 VLDVDETGTEGAAATAVTAALKSLPQTVPLLNFNRPFMLVITDNNGQSVFFMGKVTNP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 118/370 (32%)
Serpina3cNP_036789.2 SERPIN 54..415 CDD:214513 119/370 (32%)
RCL 365..392 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.