DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus


Alignment Length:365 Identity:113/365 - (30%)
Similarity:183/365 - (50%) Gaps:28/365 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL-----GLPSEDKEAVAARYGALL 82
            :|:.:|:|: |:..||:||.|..:|:.:|::|.|.|::...|     .:|..|   :...:..||
  Rat    58 ELVHQSNTS-NIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEAD---IHKAFHHLL 118

  Fly    83 NDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQT 147
            ..|...:....|...|.::||....|.:.:...|:..:.|||.|::..:...|.:.||.:|...|
  Rat   119 QTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGT 183

  Fly   148 SGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFR 212
            .|||..::.  .:..|....|||.|:|||:|:..|:|..||.:.|.|..:.:|.|.||.::|.|.
  Rat   184 QGKIVDLMK--QLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFD 246

  Fly   213 ANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVGFARPLVA--------KEVYLKL 269
            .:|...|.:.|:.:.||.:  :..|||..:...:..||:.:   .:.|::        :...|..
  Rat   247 MHYCSTLSSWVLMMDYLGN--ATAIFLLPDDGKMQHLEQTL---TKDLISRFLLNRQTRSAILYF 306

  Fly   270 PKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATS 334
            ||..|.....||..|..|||..:|.:.:||||:..| :..|:||..|||.|.::|.|.||||||.
  Rat   307 PKLSISGTYNLKTLLSSLGITRVFNNDADLSGITED-APLKLSQAVHKAVLTLDERGTEAAGATV 370

  Fly   335 VAVTNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372
            |.....: ....:..||||.|:|.::.|  ..|.|:|:.|
  Rat   371 VEAVPMS-LPPQVKFDHPFIFMIVESETQSPLFVGKVIDP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 111/360 (31%)
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 111/360 (31%)
RCL 367..386 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.