DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpinb13

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_766440.2 Gene:Serpinb13 / 241196 MGIID:3042250 Length:389 Species:Mus musculus


Alignment Length:386 Identity:122/386 - (31%)
Similarity:203/386 - (52%) Gaps:27/386 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL----GLPS---- 68
            :.|.|...::::.|:|:: :.|:..|||.|.|.:.|:.:|..|:||.|||..|    |..|    
Mouse     6 TAATQFLFDLFKELNKTN-DGNVFFSPVGISTAIGMIILGTRGATASELQKVLYTEQGTESSRIK 69

  Fly    69 ------EDKEAVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESI 127
                  |.:|.:..:...||.::........|.::||::....|...|.|...|.:.:.:..|.:
Mouse    70 SEEEEIEKREEIHHQLQMLLTEISKFSNDYDLIISNRLFGEKTYLFLQKYIDYVEKYYHASLEPV 134

  Fly   128 SLTN-GPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRAST 191
            ...| ...:.::||.||..||:.|:|.:...||:.|..|.:|:|.:||||.|:.:|....|:...
Mouse   135 DFVNAADESRKKINSWVESQTNVKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEED 199

  Fly   192 FQVTANKSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSAL-----EE 251
            |.:..|.|.||||||...:|...:..||.|:::.:||.|:::||.:.||.:::||..:     .|
Mouse   200 FWLNKNLSKPVQMMALCSSFNFTFLEDLQAKIVGIPYKNNDISMFVLLPNDIDGLEKIMDKMSPE 264

  Fly   252 KIVGFARP--LVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQV 314
            |:|.:..|  |..:.|.|:||:.::|...:|:..||.:||...|::.:|.||:.| :||......
Mouse   265 KLVEWTSPGHLEQRRVDLRLPRLQVEETYDLEPVLEAVGIHSAFSEHADYSGMSA-RSGLHAQNF 328

  Fly   315 SHKAFLEVNEEGAEAAGATSVAV-TNRAGFSTFLMADHPFAFVI--RDANTIYFQGRVVSP 372
            .|::||.|.|||.||...|.|.: .:.|.....:..:|||.|.|  |::::|.|.|:..||
Mouse   329 LHRSFLVVTEEGVEATAGTGVGLKVSSAASCELVHCNHPFLFFIRHRESDSILFFGKFSSP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 119/377 (32%)
Serpinb13NP_766440.2 SERPIN 4..389 CDD:294093 120/384 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 216 1.000 Domainoid score I2692
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3582
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.