DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina3j

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001094942.1 Gene:Serpina3j / 238395 MGIID:2182843 Length:420 Species:Mus musculus


Alignment Length:389 Identity:117/389 - (30%)
Similarity:186/389 - (47%) Gaps:40/389 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWVTSVACQTSKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLP-SEDK 71
            |.:.|:....:..:|:.|:..:.::|.|.||:||...|:.:.:||:|:|.:|:...|... :|..
Mouse    45 LTLASINTDFAFSLYKKLALKNPHKNFVFSPLSITIALASLSLGAKGNTLEEILEGLKFNLTETP 109

  Fly    72 EA-VAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVA 135
            || :...:|.||..|....:...:...|.:.|.....:...:....|..:.:|..:........|
Mouse   110 EADIHQGFGHLLQRLSQPGDQVQISTGNSMVVEKHLQILAEFKEKARALYHTEVFTADFQQPREA 174

  Fly   136 AERINQWVLDQTSGKIKGMI-DPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKS 199
            .:.:|.:|.:||.|.||.:: |....||.|   :.|...|.|:|...|||.:|...||.......
Mouse   175 RKLLNDYVSNQTQGMIKELVSDLEERTSMV---MTNFALFNGKWNMTFDPYETFMGTFIEDRRTP 236

  Fly   200 VPVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLP-----REVEGLSALEEKIVGF- 256
            |.|.|| :|...||.||||  :...|:||.|..:..:|.| ||     ::||. |.....:.|: 
Mouse   237 VKVSMM-KMKELRAPYFRDEKMKCTVVELNYKGNGKAMFI-LPDQGKMKQVEA-SLQPATLRGWR 298

  Fly   257 --ARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGK---VSQVSH 316
              .||.:..|:|  ||||.|.....|:..|.:|||:|:|:.::||||:    ||||   ||::.|
Mouse   299 KSLRPRMIDELY--LPKFSISKNYRLENILPELGIKEVFSTQADLSGI----SGGKDVRVSRMFH 357

  Fly   317 KAFLEVNEEGAEAAGATSVAVTNRAGF------STFLMADHPFAFVI--RDANTIYFQGRVVSP 372
            .|.|::.|.|.||...|    .::..|      .|.:..:.||.|.:  .|:..|.|.|::.:|
Mouse   358 SAALDMTETGTEARATT----RDKYDFLSTKSNPTVVNLNTPFLFCVLHSDSENIDFMGKINNP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 114/376 (30%)
Serpina3jNP_001094942.1 serpinA3_A1AC 37..417 CDD:381019 116/387 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.