DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina3f

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001028507.2 Gene:Serpina3f / 238393 MGIID:2182838 Length:445 Species:Mus musculus


Alignment Length:393 Identity:125/393 - (31%)
Similarity:188/393 - (47%) Gaps:43/393 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTSVACQT--------SKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGL 66
            :|||...|        :..:|:.|...:.::|:|.||.||.|.|:::.:||:.:|.||:...|..
Mouse    29 ITSVDSLTLASSNTDFAFSLYKELVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKF 93

  Fly    67 -----PSEDKEAVAARYGALLNDLQGQEEGPI-LKLANRIYVNDQYSLNQNYNLAVREPFKSEAE 125
                 |..|... ..||   |.||..|....: :...:.:::.....:...:....|..:::||.
Mouse    94 NLTETPEPDIHQ-GFRY---LLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAEAF 154

  Fly   126 SISLTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRAS 190
            :........|.:.||.:|.:.|.||||.:|  ..:......:|||.|||||:||..|||..|..|
Mouse   155 TADFQQPLEATKLINDYVSNHTQGKIKELI--SDLDKRTLMVLVNYIYFKGKWEMPFDPDDTCKS 217

  Fly   191 TFQVTANKSVPVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLP-----REVEGLSA 248
            .|.:..|:||.|.|| ::......||||  |...|:||.| ..|.|....||     ::||  ::
Mouse   218 EFYLDENRSVKVPMM-KINNLTTPYFRDEELSCTVVELKY-TGNASAMFILPDQGKMQQVE--AS 278

  Fly   249 LEEKIV----GFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGG 309
            |:.:.:    ...:|.:..|  |.||||.|.....|:..|.:|||||||:.::|||.:...|. .
Mouse   279 LQPETLRNWKDSLKPRLINE--LCLPKFSISTDYSLEHILPELGIRELFSTQADLSAITGTKD-L 340

  Fly   310 KVSQVSHKAFLEVNEEGAEAAGAT---SVAVTNRAGFSTFLMADHPFAFVIRDANT--IYFQGRV 369
            :.|||.|||.|:|.|.|.|||..|   ::.......:|..:..|.||..:|.|.||  ..|..:|
Mouse   341 RTSQVVHKAVLDVAETGTEAAAGTGYQNLQCCQGVIYSMKIYFDRPFLMIISDTNTHIALFMAKV 405

  Fly   370 VSP 372
            .:|
Mouse   406 SNP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 120/382 (31%)
Serpina3fNP_001028507.2 alpha-1-antitrypsin_like 40..405 CDD:239011 119/377 (32%)
RCL 357..382 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.