DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpinb8

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_035589.1 Gene:Serpinb8 / 20725 MGIID:894657 Length:374 Species:Mus musculus


Alignment Length:367 Identity:124/367 - (33%)
Similarity:200/367 - (54%) Gaps:22/367 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLNDL 85
            :.::||:...::||...|:|:.:.|:||::||:|:||.::...|||.....  |...:..||.::
Mouse    15 LLKILSEKDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSEVLGLSGNGD--VHQSFQTLLAEI 77

  Fly    86 QGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISL---TNGPVAAERINQWVLDQT 147
            ...:...:||.|.|::..:.......:..:..:.:::..|.:|.   |.|  ..:.||.||.::|
Mouse    78 NKTDTQYLLKSACRLFGEESCDFLSTFKESCHKFYQAGLEELSFAKDTEG--CRKHINDWVSEKT 140

  Fly   148 SGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFR 212
            .|||..::.||::....|.:||||:||||:|:::||...||...|:....|.. ||||.:...|:
Mouse   141 EGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMPFKTNQEKKT-VQMMFKHAKFK 204

  Fly   213 ANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGFARP--LVAKEVYLKLP 270
            ..:..:::.||:.|||....|||.|.||.|...|:.:|     ||:..:..|  |...:|.:.||
Mouse   205 MGHVDEVNMQVLALPYAEEELSMVILLPDESTDLAVVEKALTYEKLRAWTNPETLTESQVQVFLP 269

  Fly   271 KFKIEFRDELKETLEKLGIRELFTD-KSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATS 334
            :.|:|...:|:..|:.||:.:.|.: ::|.||: ..|....||:|:||.|:||||||.|||.||:
Mouse   270 RLKLEESYDLETVLQNLGMTDAFEETRADFSGM-TTKKNVPVSKVAHKCFVEVNEEGTEAAAATA 333

  Fly   335 VAVTNRAGFST--FLMADHPFAFVI--RDANTIYFQGRVVSP 372
            | :.|.....|  ...|||||.|.|  ...::|.|.||..||
Mouse   334 V-IRNARCCRTEPRFCADHPFLFFIWHHKTSSILFCGRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 121/362 (33%)
Serpinb8NP_035589.1 SERPIN 4..374 CDD:294093 122/365 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.