DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpinb9

DIOPT Version :10

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_033282.1 Gene:Serpinb9 / 20723 MGIID:106603 Length:374 Species:Mus musculus


Alignment Length:138 Identity:28/138 - (20%)
Similarity:48/138 - (34%) Gaps:39/138 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 FDVFNAGSFKTRY--------GAYVG-------------IPSNFEYDSAAAIDRTDIKIR----- 131
            |.::..||.:.||        |.:||             :|..|...|....|..::.::     
Mouse    22 FTIWEPGSAQLRYSVPEEAKHGTFVGRIAQDLGLELTELVPRLFRVASKDRGDLLEVNLQNGILF 86

  Fly   132 -NQPIDWGTEAGRLLEDAL----VLTEDEQVFGIARELLTMK--------THKSLIQSIIPTVSW 183
             |..||.....|:..|.::    ::....|||.:..|:..:.        |.|:|..|....:..
Mouse    87 VNSRIDREELCGKSAECSIHLEVIVDRPLQVFHVEVEVKDINDNPPVFPTTQKNLFVSETRALDS 151

  Fly   184 MFTYSLAS 191
            .|:...||
Mouse   152 RFSLEGAS 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 serpin42Dd-like_insects 12..372 CDD:381070 28/138 (20%)
Serpinb9NP_033282.1 serpin 1..374 CDD:476815 28/138 (20%)

Return to query results.
Submit another query.