DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina3g

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus


Alignment Length:389 Identity:126/389 - (32%)
Similarity:190/389 - (48%) Gaps:36/389 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTSVACQT--------SKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGL 66
            ||||...|        :..:|:.|...:.::|:|.||.||.|.|:::.:||:.:|.||:...|..
Mouse    29 VTSVDSLTLVSSNTDFAFSLYRKLVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKF 93

  Fly    67 -----PSEDKEAVAARYGALLNDLQGQEEGPI-LKLANRIYVNDQYSLNQNYNLAVREPFKSEAE 125
                 |..|... ..||   |.||..|....: :...:.:::.....:...:....|..:::||.
Mouse    94 NLTETPEPDIHQ-GFRY---LLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAEAF 154

  Fly   126 SISLTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRAS 190
            :........|.:.||.:|.:.|.||||.:|  ..:...:..:|||.|||||:|::.|||..|..|
Mouse   155 TADFQQPLKATKLINDYVSNHTQGKIKQLI--SGLKESMLMVLVNYIYFKGKWKNPFDPNDTFKS 217

  Fly   191 TFQVTANKSVPVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLP-----REVEGLSA 248
            .|.:...:||.|.|| :.|.....||||  |...|:||.| ..|.|....||     ::||. |.
Mouse   218 EFYLDEKRSVIVSMM-KTGYLTTPYFRDEELSCTVVELKY-TGNASAMFILPDQGRMQQVEA-SL 279

  Fly   249 LEEKIVGFARPLVAKEVY-LKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVS 312
            ..|.:..:...|..:.:: |:||||.|.....|:..|.:|||||:|:.::|||.:...|. .:||
Mouse   280 QPETLRKWKNSLKPRMIHELRLPKFSISTDYSLEHILPELGIREVFSTQADLSAITGTKD-LRVS 343

  Fly   313 QVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFL--MADHPFAFVIRD--ANTIYFQGRVVSP 372
            ||.|||.|:|.|:|.|||.||.:|.........||  ..:.||..:|.|  |:...|..:|.:|
Mouse   344 QVVHKAVLDVAEKGTEAAAATGMAGVGCCAVFDFLEIFFNRPFLMIISDTKAHIALFMAKVTNP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 120/378 (32%)
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 120/370 (32%)
RCL 357..382 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.