DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpini1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_033276.1 Gene:Serpini1 / 20713 MGIID:1194506 Length:410 Species:Mus musculus


Alignment Length:372 Identity:114/372 - (30%)
Similarity:201/372 - (54%) Gaps:21/372 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SKEIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL---GLPSEDKEAVAARYG 79
            |..:|..|..:..::|::.||:||...:.|:.:||:|||.||::.::   ||...::.:....:.
Mouse    30 SVNMYNHLRGTGEDENILFSPLSIALAMGMMELGAQGSTRKEIRHSMGYEGLKGGEEFSFLRDFS 94

  Fly    80 ALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVL 144
               |....:|...::||||.::|.:.:.:|:.:...::..|.:|...:..:.....|..||:||.
Mouse    95 ---NMASAEENQYVMKLANSLFVQNGFHVNEEFLQMLKMYFNAEVNHVDFSQNVAVANSINKWVE 156

  Fly   145 DQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMG 209
            :.|:..:|.::.|..........|:||:||||.|:|:|.|..||..:|.......|.:.||.|.|
Mouse   157 NYTNSLLKDLVSPEDFDGVTNLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQG 221

  Fly   210 TFRANYFRDLD------AQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGFARPLVAK 263
            .|....|.|..      .||:|:||....:||.:.|.|:...|:.||     :.|..:|..:..:
Mouse   222 EFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLALSRQEVPLATLEPLLKAQLIEEWANSVKKQ 286

  Fly   264 EVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAE 328
            :|.:.||:|.:|...:||:.|:.||:.|:|...::|:.: :||....:|:..||:.:||||||:|
Mouse   287 KVEVYLPRFTVEQEIDLKDILKALGVTEIFIKDANLTAM-SDKKELFLSKAVHKSCIEVNEEGSE 350

  Fly   329 AAGATS-VAVTNRAGFSTFLMADHPFAFVIRD--ANTIYFQGRVVSP 372
            ||.|:. :|::..|.....::.||||.::||:  :..|.|.|||::|
Mouse   351 AAAASGMIAISRMAVLYPQVIVDHPFLYLIRNRKSGIILFMGRVMNP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 111/367 (30%)
Serpini1NP_033276.1 neuroserpin 23..410 CDD:239003 114/372 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm11110
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.