DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina1c

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_033271.1 Gene:Serpina1c / 20702 MGIID:891969 Length:413 Species:Mus musculus


Alignment Length:362 Identity:102/362 - (28%)
Similarity:173/362 - (47%) Gaps:21/362 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL--GLPSEDKEAVAARYGALLNDL 85
            :|:.:|:|: |:..|||||.|..:|:.:|::|.|..::...|  .|....:..:...:..||..|
Mouse    58 ELVHQSNTS-NIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTL 121

  Fly    86 QGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTSGK 150
            ...:....|...|.::||:...|.:.:....:..:::|..|::......|.:.||.:|...|.||
Mouse   122 NRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGK 186

  Fly   151 IKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRANY 215
            |...:.  .:..|....|.|.|.|||:|:..|||..|..:.|.|..:.:|.|.||...|....::
Mouse   187 IAEAVK--KLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHH 249

  Fly   216 FRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVGFARPLVAKEV--------YLKLPKF 272
            ...|.:.|:.:.|. .|.:....||.:.: :..||:.:   ::.|::|.:        .:..|:.
Mouse   250 CSTLSSWVLLMDYA-GNATAVFLLPDDGK-MQHLEQTL---SKELISKFLLKRPRRLAQIHFPRL 309

  Fly   273 KIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVAV 337
            .|.....||..:..|||..:|.:.:||||:..:.:..|:||..|||.|.::|.|.|||.|| |.:
Mouse   310 SISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTMDETGTEAAAAT-VLL 373

  Fly   338 TNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372
            .........:..||||.|:|.:.:|  ..|.|:||.|
Mouse   374 AVPYSMPPIVRFDHPFLFIIFEEHTQSPLFVGKVVDP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 99/357 (28%)
Serpina1cNP_033271.1 SERPIN 53..410 CDD:214513 101/360 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.