DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina12

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_620180.2 Gene:Serpina12 / 191570 RGDID:708485 Length:414 Species:Rattus norvegicus


Alignment Length:364 Identity:97/364 - (26%)
Similarity:180/364 - (49%) Gaps:21/364 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLND 84
            ::.|.|:.:....|:.:||:||.|..||:.:||:.||.:|::............:...:..||..
  Rat    58 KLLQRLASNSRQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSDRDMHMGFHYLLQK 122

  Fly    85 LQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTSG 149
            |..:.:...:.:.|.::::.:....|.:....:..:.::....:..:.....:.||:::..:|..
  Rat   123 LNRETQDVKMSIGNALFMDQRLRPQQRFLKLAKNLYDADMILTNFQDLENTQKNINKYISRKTHN 187

  Fly   150 KIKGM---IDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTF 211
            :|:.|   ||||::     .||.|.|||:|:|:.:|||.:|:...|.:...|:|.|.||.|.|.:
  Rat   188 RIENMVKNIDPGTV-----MLLTNYIYFQGRWQYEFDPKQTKEEDFFIEEGKTVKVPMMFQRGMY 247

  Fly   212 RANYFRDLDAQVIELPYLNSNLSMTIFLP-----REVEGLSALEEKIVGFARPLVAKEVY-LKLP 270
            ...|...|...::|:|| ..|::.|..||     |.:|  ..|:..|....:.|::|.|. :.:|
  Rat   248 DMAYDSQLSCTILEMPY-RRNITATFVLPDSGKLRLLE--QGLQADIFAKWKSLLSKRVVDVWVP 309

  Fly   271 KFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSV 335
            :..|.....:|:.|.:|||.::|.:..||:.:.:.:| .||.:..|||.|.:||:|.|.| |.|.
  Rat   310 RLHISATYNMKKVLSRLGISKIFEEHGDLTRISSHRS-LKVGEAVHKAELRMNEKGTEGA-AGSG 372

  Fly   336 AVTNRAGFSTFLMADHPFAFVIRD--ANTIYFQGRVVSP 372
            |.|........:..:.||..:|.:  ..::.|..|:.:|
  Rat   373 AQTLPMETPRRMKLNAPFLMMIYENLMPSMIFLARIYNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 95/359 (26%)
Serpina12NP_620180.2 alpha-1-antitrypsin_like 51..408 CDD:239011 95/359 (26%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.