DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPINA12

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:392 Identity:101/392 - (25%)
Similarity:195/392 - (49%) Gaps:47/392 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WVTSVACQTSKEI--------YQLLSK---SHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQS 62
            |...:|   :||:        ::||.|   .:..:|:.:||:||.|..||:.:||:.||..|::.
Human    39 WKQRMA---AKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQ 100

  Fly    63 ALGLPSEDKEAVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESI 127
            ........::.:...:..::::|..:.:...|.:.|.::::.:....:.:....:..:.:|....
Human   101 GFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILT 165

  Fly   128 SLTNGPVAAERINQWVLDQTSGKIKGM---IDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRA 189
            :..|..:|.::||.::..:|.|||..:   ||||::     .||.|.|:|:.:|:.:|||..|:.
Human   166 NFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTV-----MLLANYIFFRARWKHEFDPNVTKE 225

  Fly   190 STFQVTANKSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEE--K 252
            ..|.:..|.||.|.||.:.|.::..|...|...::|:|| ..|::....||.|.: |..||:  :
Human   226 EDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPY-QKNITAIFILPDEGK-LKHLEKGLQ 288

  Fly   253 IVGFAR--PLVAKEVY-LKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQV 314
            :..|:|  .|:::.|. :.:|:..:....:||:||..:|:.::|.:..||:.:...:| .||.:.
Human   289 VDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRS-LKVGEA 352

  Fly   315 SHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLM-------ADHPFAFVIRDAN--TIYFQGRVV 370
            .|||.|:::|.|.|.|..|        |..|..|       .|.|:..:|....  ::.|.|::|
Human   353 VHKAELKMDERGTEGAAGT--------GAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIV 409

  Fly   371 SP 372
            :|
Human   410 NP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 97/380 (26%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 99/389 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.