DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serpina6

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:403 Identity:110/403 - (27%)
Similarity:191/403 - (47%) Gaps:45/403 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YLCIF------LWVTSVACQTSK---------------EIYQLLSKSHTNQNLVVSPVSIETILS 46
            |.|:|      ||.|........               .:|:.|...::::|.::|||||...|:
Mouse     6 YTCLFWLCTSGLWTTQAVTDEDSSSHRDLAPTNVDFAFNLYKRLVALNSDKNTLISPVSISMALA 70

  Fly    47 MVFMGAEGSTAKELQSALGL-PSEDKEAVAARYGALLND-LQGQEEGPILKLANRIYVNDQYSLN 109
            |:.:...|||  :....||. .|:..||...:....||. ||..:.|..:.:.|.:::.....|.
Mouse    71 MLSLSTRGST--QYLENLGFNMSKMSEAEIHQGFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKLK 133

  Fly   110 QNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYF 174
            .::....:..::|||.:|...:...|.|:||..|.::|.|||:.::  ..:.|....:|:|.|:.
Mouse   134 DSFLADTKHYYESEALTIPSKDWTKAGEQINNHVKNKTQGKIEHVV--SDLDSSATLILINYIFL 196

  Fly   175 KGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTI 237
            ||.|:..|.|..||...|.|....:|.|.||.|.|..  :||||  :..|::::.|:.:..:. |
Mouse   197 KGIWKLPFSPENTREEDFYVNETSTVKVPMMVQSGNI--SYFRDSAIPCQMVQMNYVGNGTTF-I 258

  Fly   238 FLPREVE---GLSAL-EEKIVGFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSD 298
            .||.:.:   .::|| .:.|..:.:.::.:::.|.:|||.:....:|::.|..:||::|||::||
Mouse   259 ILPDQGQMDTVVAALNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSD 323

  Fly   299 LSGLFAD--KSGGKVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAFVIRDAN 361
                |||  |.......|.|||.|:: :||.....||:....:....|..|..:.||.|:..|..
Mouse   324 ----FADTTKDTPLTLTVLHKAMLQL-DEGNVLPAATNGPPVHLPSESFTLKYNRPFIFLAFDKY 383

  Fly   362 T--IYFQGRVVSP 372
            |  .....:|::|
Mouse   384 TWSSLMMSQVMNP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 102/379 (27%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 103/364 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.