DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and Serping1

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_033906.2 Gene:Serping1 / 12258 MGIID:894696 Length:504 Species:Mus musculus


Alignment Length:387 Identity:108/387 - (27%)
Similarity:177/387 - (45%) Gaps:71/387 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SKEIYQLLSKSH-TNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGAL 81
            |.::|...|.:. ...|:..||.||.::|:.|.:||..||...|:|.|..|.:        :..:
Mouse   155 SVKLYHAFSATKMAKTNMAFSPFSIASLLTQVLLGAGDSTKSNLESILSYPKD--------FACV 211

  Fly    82 LNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTN----GPVAA---ERI 139
            ...|:|.....:..::...:..|         ||:|:.:.:.::|:..::    ||.:|   |.|
Mouse   212 HQALKGFSSKGVTSVSQIFHSPD---------LAIRDTYVNASQSLYGSSPRVLGPDSAANLELI 267

  Fly   140 NQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQM 204
            |.||.:.|:.||:.::|  |:.||...:|:||:|...:|:..|:|.|..|..|.  .|..:.|.|
Mouse   268 NTWVAENTNHKIRKLLD--SLPSDTCLVLLNAVYLSAKWKITFEPKKMMAPFFY--KNSMIKVPM 328

  Fly   205 MAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLP-------REVEGLSALEEKIVGFARPL 260
            |:.: .:....|.|  |.|:|.:| .|:.|||..|.:|       ::||  .||        .|.
Mouse   329 MSSV-KYPVAQFDDHTLKAKVGQL-QLSHNLSFVIVVPVFPKHQLKDVE--KAL--------NPT 381

  Fly   261 VAKEV------------YLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQ 313
            |.|.:            ||.:|..|::...::...:|||...: ||...:|.||..|.. .:||.
Mouse   382 VFKAIMKKLELSKFLPTYLTMPHIKVKSSQDMLSVMEKLEFFD-FTYDLNLCGLTEDPD-LQVSA 444

  Fly   314 VSHKAFLEVNEEGAEAAGATSVAVTNRAGFS-TFLMADHPFAFVIRDANTIY--FQGRVVSP 372
            :.|:..||:.|.|.|||.|::::.    |.| .......||.|::.|....:  |.|||..|
Mouse   445 MKHETVLELTESGVEAAAASAISF----GRSLPIFEVQRPFLFLLWDQQHRFPVFMGRVYDP 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 105/382 (27%)
Serping1NP_033906.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..67
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..141
serpinG1_C1-INH 141..500 CDD:381006 106/383 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.