DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dd and SERPINA3

DIOPT Version :9

Sequence 1:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001076.2 Gene:SERPINA3 / 12 HGNCID:16 Length:423 Species:Homo sapiens


Alignment Length:370 Identity:123/370 - (33%)
Similarity:183/370 - (49%) Gaps:27/370 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL--GLPSEDKEAVAARYGALLN 83
            :|:.|.....::|::.||:||.|.|:.:.:||..:|..|:...|  .|....:..:...:..||.
Human    60 LYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLR 124

  Fly    84 DLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTS 148
            .|....:...|.:.|.::|.:|.||...:....:..:.|||.:....:...|.:.||.:|.:.|.
Human   125 TLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTR 189

  Fly   149 GKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRA 213
            |||..:|.  .:.|....:|||.|:||.:||..|||..|..|.|.::..|.|.|.||: :.....
Human   190 GKITDLIK--DLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMS-LHHLTI 251

  Fly   214 NYFRD--LDAQVIELPYLNSNLSMTIFLP-----REVEGLSALEEKIVGFARPLVAKEV-YLKLP 270
            .||||  |...|:||.| ..|.|....||     .|||.: .|.|.:..:...|..:|: .|.||
Human   252 PYFRDEELSCTVVELKY-TGNASALFILPDQDKMEEVEAM-LLPETLKRWRDSLEFREIGELYLP 314

  Fly   271 KFKIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGK---VSQVSHKAFLEVNEEGAEAAGA 332
            ||.|.....|.:.|.:|||.|.||.|:||||:    :|.:   ||||.|||.|:|.|||.||:.|
Human   315 KFSISRDYNLNDILLQLGIEEAFTSKADLSGI----TGARNLAVSQVVHKAVLDVFEEGTEASAA 375

  Fly   333 TSVAVTNRAGF---STFLMADHPFAFVI--RDANTIYFQGRVVSP 372
            |:|.:|..:..   .|.:..:.||..:|  .|...|:|..:|.:|
Human   376 TAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 121/365 (33%)
SERPINA3NP_001076.2 serpinA3_A1AC 40..421 CDD:381019 123/370 (33%)
RCL 369..394 8/24 (33%)
O-glycosylated at one site 381..389 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.